PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G298200.1.p
Common NamePRUPE_ppa011589mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 205aa    MW: 23325.8 Da    PI: 6.512
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G298200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.31.9e-1485134554
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                         +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L+++l+  ++
  Prupe.1G298200.1.p  85 RKQRRMISNRESARRSRMRKQKHLDELWSQVVRLRNENQSLIDRLNYVSE 134
                         79****************************************98876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-1681145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.15183146IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.63E-1385135No hitNo description
Gene3DG3DSA:1.20.5.1702.1E-1285159No hitNo description
PfamPF001704.3E-1285138IPR004827Basic-leucine zipper domain
CDDcd147021.04E-1986137No hitNo description
PROSITE patternPS00036088103IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MLPGEIISGL HYLAPETPIP DPAHFGIMQN NMSSLHFNTL FNNLSQAQNF PAGHEFTQQS  60
SSLSNNSSTS DDAEEHQHLR IIDERKQRRM ISNRESARRS RMRKQKHLDE LWSQVVRLRN  120
ENQSLIDRLN YVSESHDRVV QENTKLKEEA SDLRQTLTNL QIGSPYNINA TTFRELEPEV  180
PCNTAHLRAE SSNQSIAASA DLLH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197104RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G298200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007223457.11e-150basic leucine zipper 43
SwissprotQ9FMC24e-35BZP43_ARATH; Basic leucine zipper 43
TrEMBLM5XGQ21e-148M5XGQ2_PRUPE; Uncharacterized protein
STRINGEMJ246561e-149(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16043399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13600.11e-41basic leucine-zipper 58
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]