PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G290200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family SBP
Protein Properties Length: 534aa    MW: 58584.7 Da    PI: 7.5408
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G290200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.76e-42197273177
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         +Cqv gC++dls+ k+yh+rh+vC++hsk+p v+v+g+eqrfCqqCsrfh l efD+ krsCrrrLa+hnerrrk+q
  Prupe.1G290200.1.p 197 TCQVLGCNMDLSSSKDYHKRHRVCDAHSKTPIVIVNGMEQRFCQQCSRFHLLAEFDDVKRSCRRRLAGHNERRRKPQ 273
                         6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-33193259IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.547195272IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.19E-39196277IPR004333Transcription factor, SBP-box
PfamPF031105.2E-32198271IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MLTLSHSVSA STSPKPENKI LPLSLSPCLC LSHSLRAFIV SSEGKGFLFP EEIDIQIDAF  60
ARSRKALLEW DNKTCLNFGK ESVDGTEFME LDLPDIVRKP FHTNQGVEIL SGVVGNDSSY  120
NSVASPTCLI SSSSSLGEGE SGSKFSSPVT ESNSQDSSLI ALKLGRLTDS KNGQNGQHAK  180
ERSKRGGIKG SYSHIPTCQV LGCNMDLSSS KDYHKRHRVC DAHSKTPIVI VNGMEQRFCQ  240
QCSRFHLLAE FDDVKRSCRR RLAGHNERRR KPQLDTLNCK PHKLLRSYQG TGYVGTSFAK  300
RTPFVFSDIL PGGILYPEEY AHANQYGNVK CEDESTYSQC VTPIANRQML PKSVLGKQHA  360
PGIPSSGNEY STFDAASTIQ KASGSSNSCC ALSLLSTQSH NLSGHSAGVQ VPSPSIIQQS  420
THHSVGQLYE KPSRVNSMEK CGQSGSYLHI MNSMGVDQME SVIDSSQAVD FQLHTDGGFQ  480
ESHCLSTKYC LSPEHGTTFD LLQLSSHLQR VEHERNFLQV KQEHGEYYCF PTA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-28193271684squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G290200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007226822.10.0squamosa promoter-binding-like protein 6
RefseqXP_020411209.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A251R4W00.0A0A251R4W0_PRUPE; Uncharacterized protein
STRINGEMJ280210.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.18e-51SBP family protein