PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G280700.1.p
Common NamePRUPE_ppa004312mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WRKY
Protein Properties Length: 518aa    MW: 56166.9 Da    PI: 7.4532
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G280700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.95.1e-34241297259
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         dDgynWrKYGqK+vkgsefprsYY+Ct+++Cpvkkkvers  d++++ei+Y+geHnhe
  Prupe.1G280700.1.p 241 DDGYNWRKYGQKQVKGSEFPRSYYKCTHSNCPVKKKVERSI-DGQITEIIYKGEHNHE 297
                         8****************************************.***************8 PP

2WRKY107.56.6e-34406464159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK+vkg+++prsYY+Ct++ C+v+k+ver+++dpk+v++tYeg+Hnh+
  Prupe.1G280700.1.p 406 LDDGYRWRKYGQKVVKGNPYPRSYYKCTFPACNVRKHVERASTDPKAVITTYEGKHNHD 464
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.5E-30235299IPR003657WRKY domain
SuperFamilySSF1182901.83E-26238299IPR003657WRKY domain
SMARTSM007742.1E-36240298IPR003657WRKY domain
PROSITE profilePS5081124.191240299IPR003657WRKY domain
PfamPF031068.6E-27241297IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.1E-37391466IPR003657WRKY domain
SuperFamilySSF1182902.62E-29398466IPR003657WRKY domain
PROSITE profilePS5081137.574401466IPR003657WRKY domain
SMARTSM007743.7E-39406465IPR003657WRKY domain
PfamPF031068.7E-26407464IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MAENQEQPPG PPPSTSSSPL KSAAPPPPPP PRPTITLPPR TSFETLFNSG GANSGPGFGL  60
GFSPGPMTLV SSFLSDGEDC KSFSQLLAGA MSPAARPPGF PQLENRSSAD GDDNSDFRFK  120
QNRPSPMFSV PSPGLLDSPG LFSPGQGPFG MTHQQALAQV TAQAAQSSSY FHIPTEYSSS  180
LSTAPATSLT QLPAFTSDST APQEMPSGAA DSGVVLKESS DISHSDQRSQ PSSFIVDKPN  240
DDGYNWRKYG QKQVKGSEFP RSYYKCTHSN CPVKKKVERS IDGQITEIIY KGEHNHERPQ  300
SKRAKDSGNP IGNIQANPDL ASQVHGGHLS KSKKGQESSQ ATHDHLSGTS DSEEVGDAET  360
RVDEKDEDQP DPKRRNTEVR AEPASSHRTV TEPRIIVQTT SEVDLLDDGY RWRKYGQKVV  420
KGNPYPRSYY KCTFPACNVR KHVERASTDP KAVITTYEGK HNHDVPASKT GSHYAANNNA  480
LNLRAVNAGT EKINKMDLRN NDQQPIARLR LKEEQIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-42241467878Probable WRKY transcription factor 4
2lex_A4e-42241467878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: In young, mature and senescent leaves. {ECO:0000269|PubMed:11722756}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G280700.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007222872.10.0probable WRKY transcription factor 3
SwissprotQ9ZQ701e-172WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLM5XF340.0M5XF34_PRUPE; Uncharacterized protein
STRINGEMJ240710.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-146WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]