PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G275900.1.p
Common NamePRUPE_ppa006561mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 347aa    MW: 38907.9 Da    PI: 7.645
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G275900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.27.5e-332175155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+WtpeLH+rFveav+qLGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  Prupe.1G275900.1.p 21 KPRLKWTPELHQRFVEAVTQLGGADKATPKSLMRVMGIHGLTLYHLKSHLQKYRL 75
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.7461878IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-311977IPR009057Homeodomain-like
SuperFamilySSF466892.15E-162076IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-232176IPR006447Myb domain, plants
PfamPF002491.7E-82374IPR001005SANT/Myb domain
PfamPF143791.7E-22119165IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGLLQNMQNQ NMNLVLSTDA KPRLKWTPEL HQRFVEAVTQ LGGADKATPK SLMRVMGIHG  60
LTLYHLKSHL QKYRLGKSQQ SENCTDIKQE DYKEIQSSDD HFDTDISDET HCQINESLQI  120
AESLQLQMEV QRKLHEQIEV QRHLQLRIEA QGKYLQTVLK KAQETLSGYG SSSVGVELAK  180
AELTQLVSMV NNGCPSSSFS ELTETGTSSL KYVERKQMRG SMESSLTSSE SSGRKEEKQP  240
MHKHGGDPEK SNTTCVELPL MDIHPENKPW NNVTNSHVIG RKRSSSPISD GICVEQPISK  300
RTPTQRDKSG QHLRKSGLLD TIDLNRKYQN DIDSGPKVID LNCKGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-202077158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-202077158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A7e-202177157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-202177157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-202177157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-202177157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-202077158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-202077158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-202077158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-202077158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-202077158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-202077158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G275900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020410650.10.0myb family transcription factor PHL8
SwissprotF4I2744e-87PHL8_ARATH; Myb family transcription factor PHL8
TrEMBLA0A251R4930.0A0A251R493_PRUPE; Uncharacterized protein
STRINGXP_008221605.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52183253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.12e-86G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]