PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G274300.1.p
Common NamePRUPE_ppa022278mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 483aa    MW: 53569.8 Da    PI: 7.2483
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G274300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1683.1e-52191491128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         + pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t +g+Wkatg+d++
  Prupe.1G274300.1.p  19 MLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIKQLDIYKFDPWDLPKLAASGEKEWYFYCPRDRKYRNSTRPNRVTGAGFWKATGTDRP 108
                         579***************************.89***************8888899************************************ PP

                 NAM  92 vlsk....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s+    +++ +glkk+Lvfykgra kg+ktdW+mhe+rl
  Prupe.1G274300.1.p 109 IYSSegacSSKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 149
                         ***977776777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-5717183IPR003441NAC domain
PROSITE profilePS5100556.1119183IPR003441NAC domain
PfamPF023652.4E-2521149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MDERSDMNII GGDKMDEVML PGFRFHPTDE ELVGFYLKRK IQQRPLSIEL IKQLDIYKFD  60
PWDLPKLAAS GEKEWYFYCP RDRKYRNSTR PNRVTGAGFW KATGTDRPIY SSEGACSSKC  120
IGLKKSLVFY KGRAAKGVKT DWMMHEFRLP SLTDSLQTKR SSSFMDKTIP ANDSWAICRI  180
FKKTNSSHAH QRALSHHSWV SVLPETNTYD DHMLGSKAAH SAAHHHHQHE FSSERMPLTS  240
KTNSTTNFCA NNNNDIQISS TTSSMSPLDI YTSSYKPMNP LMMGCNIKLP YQYFPISNSN  300
GDYFSSTPSF TFSSSPLETP SGPVAKCAVD VSSLLLNMSS SMLGDYNSSN SINKASAEST  360
NFEFSTTTGS QDQCNGGFSS MPLPHHHEVA QGNNNMGNGH DTVVGLIKNN VSNVNSNLTE  420
DADDQQWETN VRSNIGFPLM MSNSLPLPLN IGGGGGGDAW KSSLTWESSP CPSEMSTTRC  480
YT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-5351882170NO APICAL MERISTEM PROTEIN
1ut4_B1e-5351882170NO APICAL MERISTEM PROTEIN
1ut7_A1e-5351882170NO APICAL MERISTEM PROTEIN
1ut7_B1e-5351882170NO APICAL MERISTEM PROTEIN
4dul_A1e-5351882170NAC domain-containing protein 19
4dul_B1e-5351882170NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157164TKRSSSFM
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed at globular stage onward in the COL progenitors after the first division of the hypophyseal cell. Later observed in these cells and their descendants, mostly in direct daughter cells. Also detected in the Epi/LRC stem cells and daughters, and is retained in maturing LRC layers. Present in elongated stem cells that are about to divide. {ECO:0000269|PubMed:19081078}.
UniprotTISSUE SPECIFICITY: Expressed in root cap stem cells and their immediate daughters. {ECO:0000269|PubMed:19081078}.
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G274300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4782683e-47AM478268.2 Vitis vinifera contig VV78X141573.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007224891.10.0protein FEZ
SwissprotQ9ZVH01e-103FEZ_ARATH; Protein FEZ
TrEMBLM5Y2Y70.0M5Y2Y7_PRUPE; Uncharacterized protein
STRINGEMJ260900.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-101NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]