PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G238200.5.p
Common NamePRUPE_ppa002679mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 566aa    MW: 63342.6 Da    PI: 6.3833
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G238200.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like76.24.4e-24148201155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Prupe.1G238200.5.p 148 KARVVWSVDLHQKFVKAVHQI-GFDKVGPKKILDLMNVPWLTRENVASHLQKYRL 201
                         68*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011011.855182IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521721.05E-121688IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23007.7E-71644No hitNo description
Gene3DG3DSA:3.40.50.23002.3E-104589No hitNo description
SuperFamilySSF466893.85E-17146205IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27146206IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-21148201IPR006447Myb domain, plants
PfamPF002495.9E-8150200IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MESSFSSPRN DSFPAGLRVL VVDDDPTWLK ILEKMLKKCS YEVMSVDGET SRVMKGVQHG  60
ACDYLLKPIR MKELRNIWQH VFRKKIHEIR DIESHESIEG IQLIRNGSDQ YDEGYFFSAE  120
DLTSSRKRKD VDNKYDDKDF SDCSSAKKAR VVWSVDLHQK FVKAVHQIGF DKVGPKKILD  180
LMNVPWLTRE NVASHLQKYR LYLSRLQKEN DIKSSFGGTK HSDYSSKDLQ GILSVQNSIN  240
IQQNDVAHGS YRFSGNNLVA QNADPKSNEG DIKGIVSEPV AEPKKGTTGN IPDSQKTRSS  300
QMDFNSSYAE TQKGLVGNVP DSQKIRSSQM RVNHSFASVE SEVNLTAFDS TIPATYSWNK  360
IQLEKEHKPL IQLNNGFSKP QLPGPQHHFQ ADQLQSIPSI SSRPSIPGGD VTGSSKSKPS  420
YSEYTNHHGS HVSPTISPTI SATDSFPGQT KSCVVDHQLS ETISTSTSNM KNQGINLSTD  480
LESAQRNLIL GSTSPFASLD DEFQICWYQG DCYGMNLELQ NVEFSEYTDP THVTEVPAHL  540
YDALRFEYPC DPSEYSVLDQ GLFIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-17144206163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G238200.5.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020409742.10.0two-component response regulator ARR11
TrEMBLA0A251R3E30.0A0A251R3E3_PRUPE; Uncharacterized protein
STRINGEMJ281550.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.13e-90response regulator 11