PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G197700.1.p
Common NamePRUPE_ppa005999mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 434aa    MW: 47289.4 Da    PI: 6.5135
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G197700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.12.5e-10231289563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l++e+
  Prupe.1G197700.1.p 231 KRAKRIWANRQSAARSKERKMRYIAELEQKVQTLQTEATSLSAQLTLLQRDTNGLTAEN 289
                         9*********************************************9998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.5E-16227291IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.932229292IPR004827Basic-leucine zipper domain
PfamPF001705.4E-9231285IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.56E-11231282No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-10231285No hitNo description
CDDcd147033.23E-25232281No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MDKDKSPAHG GGLPPPSGRY SGFLPTGTPF NVKPEPASSS LFPPLASGAS ADSGHFGHGM  60
SAESSHFSHD ISRMPDNPPR KLGHRRAHSE ILTLPDDISF DSDLGVVGGA DGPSFSDETE  120
EDLFSMYLDM EKFNSSSATS SFQFGEPSSS AAAPVPALTP ALRAPTSSAE NIAIGSNERP  180
RVRHQHSQSM DGSTSIKPEM LVSSSEDISA ADSKKALSAA KLAELALIDP KRAKRIWANR  240
QSAARSKERK MRYIAELEQK VQTLQTEATS LSAQLTLLQR DTNGLTAENS ELKLRLQTME  300
QQVHLQDALN DALKEEIQHL KVLTGQAMPN GGPMMNFASF GSGQQFYPNN QAMHTLLTAQ  360
QFQQLQIHSQ KQQHQFQQHQ LHQLQQQQMQ QQQQQQQQQQ QPQSGDLKMG GSIPSPSQKD  420
NTSEVNQSVT KDC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.17930.0fruit
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively at a low level in young seedlings and in roots, stems and leaves of mature plants.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G197700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007222380.10.0probable transcription factor PosF21
SwissprotQ040881e-159POF21_ARATH; Probable transcription factor PosF21
TrEMBLM5XCD00.0M5XCD0_PRUPE; Uncharacterized protein
STRINGEMJ235790.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55173249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-143bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]