PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G196000.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 178aa    MW: 20815.9 Da    PI: 10.1433
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G196000.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR185.21e-2612100290
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         fY+eYA++vGF +r+ + ++s+r+g+i  r++ C+keg+  + + k    r++ra+tr gCka+++vk +k++kw++tk+ ++HnH+l+
  Prupe.1G196000.4.p  12 FYDEYARRVGFVMRVMSCRRSERDGRILARRLGCNKEGHCVSIRGKFGPVRKPRASTREGCKAMIHVKYDKSSKWVITKFIKDHNHPLV 100
                         9**************************************99999998****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.6E-2412100IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MEFESEDAAK IFYDEYARRV GFVMRVMSCR RSERDGRILA RRLGCNKEGH CVSIRGKFGP  60
VRKPRASTRE GCKAMIHVKY DKSSKWVITK FIKDHNHPLV VSPREARQTM DEKDKKIQEL  120
TAELRNKKRL CTTYQEQLTA FTKIVEEYSD QLSKKVQNVV SNLKEFESID RELSQHR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G196000.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222477.11e-130PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_016648093.11e-130PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_020409810.11e-130protein FAR1-RELATED SEQUENCE 5
RefseqXP_020409811.11e-130protein FAR1-RELATED SEQUENCE 5
RefseqXP_021833156.11e-130protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A251R2Y81e-129A0A251R2Y8_PRUPE; Uncharacterized protein
STRINGXP_008222477.11e-130(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.11e-107FAR1 family protein