PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G196000.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 152aa    MW: 17278.7 Da    PI: 8.9151
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G196000.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR185.86.6e-2744132290
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         fY+eYA++vGF +r+ + ++s+r+g+i  r++ C+keg+  + + k    r++ra+tr gCka+++vk +k++kw++tk+ ++HnH+l+
  Prupe.1G196000.3.p  44 FYDEYARRVGFVMRVMSCRRSERDGRILARRLGCNKEGHCVSIRGKFGPVRKPRASTREGCKAMIHVKYDKSSKWVITKFIKDHNHPLV 132
                         9**************************************99999998****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.7E-2444132IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MDSDEGARAV ESSSSQALVL YEADSILEPY EGMEFESEDA AKIFYDEYAR RVGFVMRVMS  60
CRRSERDGRI LARRLGCNKE GHCVSIRGKF GPVRKPRAST REGCKAMIHV KYDKSSKWVI  120
TKFIKDHNHP LVVSPREARQ TMFPKLSNED N*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G196000.3.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222477.11e-103PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_016648093.11e-103PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_020409810.11e-103protein FAR1-RELATED SEQUENCE 5
RefseqXP_020409811.11e-103protein FAR1-RELATED SEQUENCE 5
RefseqXP_021833156.11e-103protein FAR1-RELATED SEQUENCE 5-like
SwissprotQ9SZL82e-26FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A251R0731e-108A0A251R073_PRUPE; Uncharacterized protein
STRINGXP_008222477.11e-102(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.15e-75FAR1 family protein
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]