PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G119200.1.p
Common NamePRUPE_ppa015860mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 442aa    MW: 49126.9 Da    PI: 6.9397
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G119200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS262.51.5e-80554281374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl......f 84 
                         l +lLl++Ae v++++  +a++l +  + l+s+ g+++qR++ yf++AL+++  r ++ ++++  ++++   ++ +e+ +a ++      f
  Prupe.1G119200.1.p  55 LAHLLLAFAEKVAKQQYGCARKLQNLCHFLSSSCGNSVQRVVYYFAKALQEKTDReTGRNTSEGSESRDVLAMHFQEA-MASSTpalmacF 144
                         579*****************9988888888************************955555555555555554443333.222223444447 PP

                GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgv 174
                          ev P+++++ ++  qaI+e+v++++++H iD+ i  G++ + L+qaLa+R e p   l++T+vg    +s+e++e tg+rLa+fAe+l++
  Prupe.1G119200.1.p 145 LEV-PFYQITEFAGIQAIVESVASAKKIHFIDLAIRTGGHCIVLMQALATRYECPIeLLKVTAVGV---TSREKMEDTGRRLAQFAEALKL 231
                         775.***********************************************97665499*******...68******************** PP

                GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                         pf+f+v ++k+++d++ ++++++ gE+ aV + l l ++++++ ++es    ++k++++l+P+++v++e ea+hns++F +rf eal yys
  Prupe.1G119200.1.p 232 PFSFKVAMVKDIKDVNEDTFELEDGETAAVYCPLLLCSTMRQPSCSES----LIKVLRNLNPHLMVITEIEANHNSPTFTNRFNEALLYYS 318
                         ******9********************************988888888....*************************************** PP

                GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveees 355
                         a f++l++ + r s  r+ +E+ +l+ ei+n++a eg+er+ r+ +   Wr  + ++G+ +++ls +   qa+l+ ++++ +   +++ + 
  Prupe.1G119200.1.p 319 AYFECLDVCMDRGSAYRMELEETYLSLEIKNIIASEGKERIIRRMKIDAWRTLFAKSGMVEAELSLSSLYQADLVAKQFAcGSCCTLDANG 409
                         ********************************************************************************9999******* PP

                GRAS 356 gslvlgWkdrpLvsvSaWr 374
                         + l+ gWk+ p++s+S+W+
  Prupe.1G119200.1.p 410 KGLIVGWKGTPILSLSVWK 428
                         ******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.85429407IPR005202Transcription factor GRAS
PfamPF035145.2E-7855428IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MSCVPGLSTV EVMRVARASF IHFSSRRYAD DCMPARVLGS APLGLSDQET KDVELAHLLL  60
AFAEKVAKQQ YGCARKLQNL CHFLSSSCGN SVQRVVYYFA KALQEKTDRE TGRNTSEGSE  120
SRDVLAMHFQ EAMASSTPAL MACFLEVPFY QITEFAGIQA IVESVASAKK IHFIDLAIRT  180
GGHCIVLMQA LATRYECPIE LLKVTAVGVT SREKMEDTGR RLAQFAEALK LPFSFKVAMV  240
KDIKDVNEDT FELEDGETAA VYCPLLLCST MRQPSCSESL IKVLRNLNPH LMVITEIEAN  300
HNSPTFTNRF NEALLYYSAY FECLDVCMDR GSAYRMELEE TYLSLEIKNI IASEGKERII  360
RRMKIDAWRT LFAKSGMVEA ELSLSSLYQA DLVAKQFACG SCCTLDANGK GLIVGWKGTP  420
ILSLSVWKFH AVNAKTAKYL M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-338542833375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007226926.10.0hypothetical protein PRUPE_ppa015860mg
TrEMBLM5Y8020.0M5Y802_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s15330.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-53RGA-like 2