PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G088700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 322aa    MW: 36564.2 Da    PI: 6.3738
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G088700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM132.82.5e-41421672128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         ppG+rF+P d elv  yL+kk+++++l+  + i++v++y+++P +L + +++ +e+e+yfF++rdkky++g r+nra+ +gyWkatg +k 
  Prupe.1G088700.1.p  42 PPGYRFKPLDGELVAIYLRKKIANEPLPP-NKIHDVELYRFNPDTLSEIYESyGEDEMYFFTSRDKKYPNGARPNRAAGDGYWKATGVKKI 131
                         9*************************999.77**************8544443778********************************887 PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v+  ++ +vg k++Lvfy+g+ p+g ktdW mhe+++
  Prupe.1G088700.1.p 132 VKF-EDVEVGSKTSLVFYRGKPPHGDKTDWKMHEFQV 167
                         777.9999***************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-4937192IPR003441NAC domain
PROSITE profilePS5100547.37841192IPR003441NAC domain
PfamPF023651.8E-2042166IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MEKQSISSKA SIVTKNGSDL HGGHTGSYDS YYDDASYFDS IPPGYRFKPL DGELVAIYLR  60
KKIANEPLPP NKIHDVELYR FNPDTLSEIY ESYGEDEMYF FTSRDKKYPN GARPNRAAGD  120
GYWKATGVKK IVKFEDVEVG SKTSLVFYRG KPPHGDKTDW KMHEFQVNAP PKRKDRNDMR  180
LDDCVLCRIY NKHNHSKDSN QSNNNGVEIQ EQHNVGSNSQ DNAHVSGEVV DHPPANSHEL  240
TSLLSNQKCY YNTDQSENLN SANCIGFDGP FGVVSISSAL PFQNPQQFNG YQKRQRFCDL  300
PSEFYTNYDQ WLNDTAKDLT H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-474019716170NO APICAL MERISTEM PROTEIN
1ut4_B5e-474019716170NO APICAL MERISTEM PROTEIN
1ut7_A5e-474019716170NO APICAL MERISTEM PROTEIN
1ut7_B5e-474019716170NO APICAL MERISTEM PROTEIN
3swm_A6e-474019719173NAC domain-containing protein 19
3swm_B6e-474019719173NAC domain-containing protein 19
3swm_C6e-474019719173NAC domain-containing protein 19
3swm_D6e-474019719173NAC domain-containing protein 19
3swp_A6e-474019719173NAC domain-containing protein 19
3swp_B6e-474019719173NAC domain-containing protein 19
3swp_C6e-474019719173NAC domain-containing protein 19
3swp_D6e-474019719173NAC domain-containing protein 19
4dul_A5e-474019716170NAC domain-containing protein 19
4dul_B5e-474019716170NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G088700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020420935.10.0NAC transcription factor 29
TrEMBLA0A251QUH20.0A0A251QUH2_PRUPE; Uncharacterized protein
STRINGXP_008223716.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101121642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.12e-51NAC domain containing protein 32