PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G007000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 312aa    MW: 33631.2 Da    PI: 6.254
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G007000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.24.3e-344296155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt eLHerFv+av+qLGG++kAtPk+i+++m+vkgLtl+h+kSHLQkYRl
  Prupe.1G007000.1.p 42 KPRLRWTAELHERFVDAVTQLGGPDKATPKAIMRTMGVKGLTLYHLKSHLQKYRL 96
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8113999IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-333997IPR009057Homeodomain-like
SuperFamilySSF466891.63E-174199IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-244297IPR006447Myb domain, plants
PfamPF002496.5E-94495IPR001005SANT/Myb domain
PfamPF143797.7E-27143189IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MYSAIHSLPM DGSICGHGEF SGSLDGTNLP GDACLVLTTD PKPRLRWTAE LHERFVDAVT  60
QLGGPDKATP KAIMRTMGVK GLTLYHLKSH LQKYRLGKQS CKDSAENSKD GIAASCIAES  120
QDTGSSSATS SRVIAQDLND GYQVTEALRV QMEVQRRLHE QLEVQRRLQL RIEAQGKYLQ  180
SILEKACKAL NDQAASAAGL EAAKEELSEL AIKVSNDCEG ITPLDTMKMP SLSEIAAALE  240
NRNASNVLAR LGNCSVDSCL ASTGTPVSPM DMSSLAAAMK KRQRPFFGNG DSLPLEGNMR  300
QEVEWMMSNI G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-204298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-204298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-204298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-204298157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.170211e-157fruit
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G007000.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007225561.20.0protein PHR1-LIKE 3 isoform X1
SwissprotQ8LAJ71e-140PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLA0A251QQX10.0A0A251QQX1_PRUPE; Uncharacterized protein
STRINGXP_008224497.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133672126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-122G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]