PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c9_8580V3.1.p
Common NamePHYPADRAFT_160637
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family G2-like
Protein Properties Length: 536aa    MW: 58448.6 Da    PI: 6.175
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c9_8580V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.68.7e-31294349156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k+r++W+peLH+ Fv+a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Pp3c9_8580V3.1.p 294 KARRCWSPELHRLFVNALHQLGGSQIATPKQIRELMKVDGLTNDEVKSHLQKYRLH 349
                       68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.237290351IPR017930Myb domain
SuperFamilySSF466893.36E-17292352IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-28292352IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-25294349IPR006447Myb domain, plants
PfamPF002499.1E-8296347IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MGSPIDLTLG CNTQAPSSNG RYNDHRNSSA CLEDCLESLR KAEDYVRTLE EERRKVEGFK  60
RELPLCIQLL EDAIRTSKEK LLRGKDLPQQ LKANSMDSGK DQHGVSSGPG CRHTLEEFMP  120
LKRRWERDQP SVSSDGERGE DRSSKRPAWM TEALLSKRTP ASPEKETRLT QEHSELSVSE  180
QEHSWVTSSQ MLLGANQRPT GAFLPFIREQ HGVNSFLSRP TPRPAGSGAD LSLSLCEPTT  240
TQTGHTLRPS GSEVGSIDAG RQTVDVPVAE DMGVISNGTS GAGSSSVGGN PSRKARRCWS  300
PELHRLFVNA LHQLGGSQIA TPKQIRELMK VDGLTNDEVK SHLQKYRLHT RRPSSSPQPA  360
GAGQSPKLVV LGGIWVPPQY AASGSQPSSG VYDPSIAHPP QPTEFCPTSL PQDYFACINN  420
DTSSVSLQMH RQPIFEQPIF EQPKQAGTSQ SQNSPQGPLH VTSQLSSATQ GPSSEVYHDE  480
SPGEEEAKSE GTSWQREDLK SEEPTKPNVR FSLGAGSGDV QSHAHASEEE ENQIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-14294347154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14294347154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14294347154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14294347154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.175390.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024383945.10.0transcription factor HHO2-like
TrEMBLA9RRP70.0A9RRP7_PHYPA; Predicted protein
STRINGPP1S24_189V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP43031624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-64G2-like family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]