PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c9_4910V3.1.p
Common NamePHYPADRAFT_169169
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 407aa    MW: 44349.9 Da    PI: 6.5055
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c9_4910V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.31.5e-3766125362
            zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        k+l+cprC+s+ntkfCyynnys++qPr+fC++C+ryWt GG+lrnvPvGgg+rk++++s
  Pp3c9_4910V3.1.p  66 PKNLPCPRCQSMNTKFCYYNNYSVNQPRHFCRNCQRYWTVGGTLRNVPVGGGSRKKHSRS 125
                       67899**************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2165114IPR003851Zinc finger, Dof-type
PfamPF027016.7E-3268123IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.40769123IPR003851Zinc finger, Dof-type
PROSITE patternPS01361071107IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MHLPLQHQAR LAGSFDDENE ELDAQLQANS ASHSHSHHSQ EDDASQSQGS KGSGGDAAVP  60
DGAPKPKNLP CPRCQSMNTK FCYYNNYSVN QPRHFCRNCQ RYWTVGGTLR NVPVGGGSRK  120
KHSRSRSRSD PYYRPEPNPS HDSDGEMEQI GNPLHPGLAA AAMAGIIPQD IASLHSEAGF  180
PDFGELSEAP FHPNKIYSLL QLALLQNEGM YGIPGMPFTV GNPDHEQAEL HQLFQGQAAS  240
NPGNLLTAAA AMMFMPELDP AAVALLHKAT LWAEAQQVQA MARRQTAQSA PPWVEERECK  300
PTVSAHMNRE IAAMEELRHR QQAAAGSHRR PGFWETALMH SRPNKRQAWD GTKPSLSPPS  360
VQHGSASTVD EESGNPVNAS GFSHNYDDTS SWGSAGFHPG PDLYYQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.93670.0gametophore
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024385660.10.0uncharacterized protein LOC112287144
TrEMBLA9TBM00.0A9TBM0_PHYPA; Predicted protein
STRINGPP1S199_87V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.11e-25Dof family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]