PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c9_3340V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 764aa    MW: 85050.5 Da    PI: 5.5588
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c9_3340V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS335.31.1e-1023867542374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL +cA avs+g++  a  +La+l+ l+sp+gd mqR+a+yf+eAL a+l++++++ly  ++ ++ s    ++ l+a++ +++++P++k+s
  Pp3c9_3340V3.3.p 386 TDLLHRCAFAVSQGKTGSAADYLAELRSLSSPYGDYMQRMAHYFMEALVAKLSGTGEQLYTVITNNHPS---AATMLKAYRQYVDCCPYIKLS 475
                       5799********************************************************999888887...899****************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       h+   ++ l+a+eg++rvH++ ++i++G+ Wp+L+q L++Rpegpp +RiTgv+ p +g     ++++tg+rLa+fA+  +vpfef++ +a +
  Pp3c9_3340V3.3.p 476 HFFETKMTLDAFEGATRVHVVHYGIQYGVEWPSLIQHLSKRPEGPPYFRITGVDVPYPGddPCWKIHQTGRRLAEFAKMWNVPFEFHA-LAGK 567
                       *******************************************************9999777889***********************.599* PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                       +e+++ ++++++++E+laV ++ ++h++ldesv  +s+r+ +L+ ++sl+Pk++ ++  +a +n++ F++rf e++++ysa+f+ +e ++p++
  Pp3c9_3340V3.3.p 568 WESFTAKDFNLRSDEVLAVTSH-KMHNILDESVLGSSPRELLLRRIRSLNPKLFFIIVDNAACNGPFFMTRFRESVKHYSAIFNGMELSFPED 659
                       *******************975.6********************************************************************* PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       + +r+++Ere++grei n+vaceg++r+ r+e +++W++rl++aGFk+v+ ++ + +++k++++++++d y v  ++g+++lg k++ + + S
  Pp3c9_3340V3.3.p 660 DPDRVVLEREIFGREILNIVACEGQARVDRQEPYRQWQNRLQRAGFKQVQPKKIILSKMKAMMATFHKD-YGVGIDEGWFLLGIKNQIVKANS 751
                       *******************************************************************77.*********************** PP

              GRAS 372 aWr 374
                       +W+
  Pp3c9_3340V3.3.p 752 CWE 754
                       **5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.815359735IPR005202Transcription factor GRAS
PfamPF035143.9E-100386754IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 764 aa     Download sequence    Send to blast
MTEKATSDSS NPVRRGSGGS SLESLLQQAC LQLQKPKLQR RSESDPRLDV SVEKRVNLDS  60
ACLGDAADGL GETYFHKIRP EANSNFLERT APPKLETISK KTNVPRSNSG CVLGGRGSPL  120
GTSDNSSQFS PSPTRSLSND TQASVSGGNC DAVDFEGSSS VSADLAGQME SMIRYIDDIL  180
MNENMEDEKS LMQQTGAIHA MAKDLAGLID PDSSVDETNN LEVVGGDYSN DWAKNEILSA  240
EETNAVENSS VYRDLRKEIA DLISSEANVL DAGGFGGDND QSNTSTTFLP TEDNTTLKLM  300
EGYTRMLSKH IADVSGASNS DNVDYRSFIT ESDDLVVHFD DRLKYYLDNL NKNPPPNSAL  360
DFKLLLRTPG ERSSSSSSRV VYSSITDLLH RCAFAVSQGK TGSAADYLAE LRSLSSPYGD  420
YMQRMAHYFM EALVAKLSGT GEQLYTVITN NHPSAATMLK AYRQYVDCCP YIKLSHFFET  480
KMTLDAFEGA TRVHVVHYGI QYGVEWPSLI QHLSKRPEGP PYFRITGVDV PYPGDDPCWK  540
IHQTGRRLAE FAKMWNVPFE FHALAGKWES FTAKDFNLRS DEVLAVTSHK MHNILDESVL  600
GSSPRELLLR RIRSLNPKLF FIIVDNAACN GPFFMTRFRE SVKHYSAIFN GMELSFPEDD  660
PDRVVLEREI FGREILNIVA CEGQARVDRQ EPYRQWQNRL QRAGFKQVQP KKIILSKMKA  720
MMATFHKDYG VGIDEGWFLL GIKNQIVKAN SCWESKPVLN FMS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-4939175325378Protein SCARECROW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.174300.0protonema
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024384043.10.0scarecrow-like protein 34
TrEMBLA0A2K1K1U00.0A0A2K1K1U0_PHYPA; Uncharacterized protein
STRINGPP1S213_67V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.16e-99SCARECROW-like 14