PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c9_23930V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 167aa    MW: 18536 Da    PI: 6.9849
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c9_23930V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.21.7e-4431021100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+C++dCv+apyfp ++p+kfanvhk+FGa+nv k+l++lp e r da+ss+vyeA+ar+rdPvyG+vg i++lqqq+++l++
  Pp3c9_23930V3.3.p   3 PCAACKLLRRRCTRDCVFAPYFPPDEPQKFANVHKVFGAANVNKMLQELPVEARGDAVSSMVYEADARVRDPVYGCVGAISSLQQQVAHLQT 94 
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +la++++e
  Pp3c9_23930V3.3.p  95 QLAVANAE 102
                        ***99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.8692103IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-443100IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MSPCAACKLL RRRCTRDCVF APYFPPDEPQ KFANVHKVFG AANVNKMLQE LPVEARGDAV  60
SSMVYEADAR VRDPVYGCVG AISSLQQQVA HLQTQLAVAN AEIVCMRIHN TESSSDCGTP  120
HHMQGSYQQG LSPPLQPQSP ELHHYHKPTA YYHRMDNSEL AELLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-48210410112LOB family transfactor Ramosa2.1
5ly0_B6e-48210410112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024384061.11e-123LOB domain-containing protein 4-like
RefseqXP_024384062.11e-123LOB domain-containing protein 4-like
RefseqXP_024384063.11e-123LOB domain-containing protein 4-like
RefseqXP_024384064.11e-123LOB domain-containing protein 4-like
SwissprotQ8LBW31e-57LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A2K1K4B41e-122A0A2K1K4B4_PHYPA; Uncharacterized protein
STRINGPP1S238_53V6.11e-123(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-60LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]