PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c9_22420V3.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 192aa    MW: 21694.2 Da    PI: 6.7735
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c9_22420V3.5.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.91e-1975127456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        + +ft  ql+ Le++F++ + p+a++++ LA++lg++ rqV vWFqNrRa+ k
  Pp3c9_22420V3.5.p  75 KLRFTMAQLRHLEDAFARLQRPNAHQKAALATELGIQPRQVEVWFQNRRARGK 127
                        568************************************************88 PP

2HD-ZIP_I/II92.45e-3074154282
        HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLek 82 
                        +k+r++  q++ LE+ F + ++ + ++K++la+eLg+qprqv+vWFqnrRAR k+k++E+++e+L++++  l  en++L+ 
  Pp3c9_22420V3.5.p  74 QKLRFTMAQLRHLEDAFARLQRPNAHQKAALATELGIQPRQVEVWFQNRRARGKAKRTETNCEVLRQRCHDLIVENQQLNY 154
                        79***************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.68269129IPR001356Homeobox domain
SMARTSM003897.2E-1571133IPR001356Homeobox domain
SuperFamilySSF466897.7E-1771129IPR009057Homeodomain-like
PfamPF000465.0E-1775127IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-1876132IPR009057Homeodomain-like
CDDcd000865.52E-1577125No hitNo description
PRINTSPR000316.9E-6100109IPR000047Helix-turn-helix motif
PROSITE patternPS000270104127IPR017970Homeobox, conserved site
PRINTSPR000316.9E-6109125IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MGSNYHYYTK LLLPGRENDT DFSAGSNGNC ECDDSSQRSR QYLHLDQRLI LKTVFPGGLS  60
DNSPEYDDDE GANQKLRFTM AQLRHLEDAF ARLQRPNAHQ KAALATELGI QPRQVEVWFQ  120
NRRARGKAKR TETNCEVLRQ RCHDLIVENQ QLNYLIQTES VGLDSHDLMG NGESPLQLQL  180
ALCNSCKKAP S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024384248.11e-142homeobox-leucine zipper protein HOX17-like
RefseqXP_024384249.11e-142homeobox-leucine zipper protein HOX17-like
RefseqXP_024384250.11e-142homeobox-leucine zipper protein HOX17-like
TrEMBLA0A2K1K4811e-141A0A2K1K481_PHYPA; Uncharacterized protein
STRINGPP1S454_12V6.11e-108(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-22HD-ZIP family protein