PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c9_15250V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LFY
Protein Properties Length: 312aa    MW: 34604.2 Da    PI: 7.144
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c9_15250V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY413.2e-1313820848121
            FLO_LFY  48 lreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrle 121
                          +l+ +f ++G+r  tv+ki+e+Gft++tL+    +el  l++s+ +     l +Ge +Gik a +  +r  +
  Pp3c9_15250V3.3.p 138 SVDLDTFFDGFGLRPETVVKIKEMGFTAKTLMSNL-DELPSLLESINQH--HPLTLGEEWGIKGAAKKWQREQT 208
                        4489***************************9866.5899999999985..57889*******99876555433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.0E-7140203IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MVKVKGVEWN HVIVLKEPEK HGMATLVRCI HCDKEFQGNA MRIRAHLLGN KRQAGVTGCP  60
TVPDDAREEL RLIEIAREQT QKKRKPVKMR GVRGTSSASD HSSGSADHFD GKGGLGRKAE  120
RISLQHELLA RMGSIMASVD LDTFFDGFGL RPETVVKIKE MGFTAKTLMS NLDELPSLLE  180
SINQHHPLTL GEEWGIKGAA KKWQREQTFL AHPEDEKWPD SEDTCKEVAC IDTEEVTQLE  240
PYPKWIPQQQ QGQQLQSPHN HLAPPNLSVS NLSPPNQGVT DFFSGWSRWV SGKGGVLYES  300
SGIPSSGERS L*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.108450.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024384641.10.0uncharacterized protein LOC112286713 isoform X2
TrEMBLA9SH890.0A9SH89_PHYPA; Predicted protein
STRINGPP1S78_224V6.10.0(Physcomitrella patens)