PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c9_15250V3.1.p
Common NamePHYPADRAFT_233441
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LFY
Protein Properties Length: 337aa    MW: 37367.2 Da    PI: 7.2137
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c9_15250V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY413.2e-1313720847121
            FLO_LFY  47 klreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrle 121
                        +  +l+ +f ++G+r  tv+ki+e+Gft++tL+    +el  l++s+ +     l +Ge +Gik a +  +r  +
  Pp3c9_15250V3.1.p 137 ASVDLDTFFDGFGLRPETVVKIKEMGFTAKTLMSNL-DELPSLLESINQH--HPLTLGEEWGIKGAAKKWQREQT 208
                        24489***************************9866.5899999999985..57889*******99876554433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.1E-7140203IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MVKVKGVEWN HVIVLKEPEK HGMATLVRCI HCDKEFQGNA MRIRAHLLGN KRQAGVTGCP  60
TVPDDAREEL RLIEIAREQT QKKRKPVKMR GVRGTSSASD HSSGSADHFD GKGGLGRKAE  120
RISLQHELLA RMGSIMASVD LDTFFDGFGL RPETVVKIKE MGFTAKTLMS NLDELPSLLE  180
SINQHHPLTL GEEWGIKGAA KKWQREQTFL AHPEDEKWPD SEDTCKEVAC IDTEEVTQLE  240
PYPKWIPQQQ QGQQLQSPHN HLAPPNLSVS NLSPPNQGVT DAGPGGSPGR VGYYTNLLAY  300
QAQGNARFEI MREVDVTSQR QPQVKHSFDH GAATTF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.108450.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024384640.10.0uncharacterized protein LOC112286713 isoform X1
TrEMBLA0A2K1K3A90.0A0A2K1K3A9_PHYPA; Uncharacterized protein
STRINGPP1S78_224V6.10.0(Physcomitrella patens)
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]