PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c8_440V3.4.p
Common NamePHYPADRAFT_150953
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 327aa    MW: 36661.3 Da    PI: 4.6829
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c8_440V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.5e-1892145356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k++++t +q++ Le+ Fe ++++  +++ +LAk+lg+  rqV vWFqNrRa++k
  Pp3c8_440V3.4.p  92 KKRRLTLDQVRSLERNFEVENKLEPDRKMQLAKELGMRPRQVAVWFQNRRARWK 145
                      456899***********************************************9 PP

2HD-ZIP_I/II117.57.3e-3891183193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekkrrl+ +qv++LE++Fe e+kLep+rK++la+eLg++prqvavWFqnrRAR+ktkqlE+dye+L + +++lk++ e + +e++ L++el++
  Pp3c8_440V3.4.p  91 EKKRRLTLDQVRSLERNFEVENKLEPDRKMQLAKELGMRPRQVAVWFQNRRARWKTKQLERDYETLEAGFKRLKADYELVLDEKNYLKAELQR 183
                      69***************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.99E-1982149IPR009057Homeodomain-like
PROSITE profilePS5007116.92587147IPR001356Homeobox domain
SMARTSM003893.2E-1590151IPR001356Homeobox domain
PfamPF000462.2E-1592145IPR001356Homeobox domain
CDDcd000869.96E-1692148No hitNo description
Gene3DG3DSA:1.10.10.605.8E-1994154IPR009057Homeodomain-like
PRINTSPR000311.4E-5118127IPR000047Helix-turn-helix motif
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PRINTSPR000311.4E-5127143IPR000047Helix-turn-helix motif
PfamPF021832.1E-12147186IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MAISSTGYYS GQNEMFMRDE STSNSLAAML SPCLPQVDLQ ARRYGGGNLE DDGRVQGVGQ  60
KRPSFATNDS TTVEDGAEDG DEGTASASHL EKKRRLTLDQ VRSLERNFEV ENKLEPDRKM  120
QLAKELGMRP RQVAVWFQNR RARWKTKQLE RDYETLEAGF KRLKADYELV LDEKNYLKAE  180
LQRLSGDTLG YKQGDDNQGA ESSKIPERDL DVSISVARQH NARASPTVDT SLAKEETRGS  240
TDGSSSDIVD ADSPRSTDSS RISAIQSHDF PPESFMVHPE LLQIYSEETL HPDSAVKLED  300
GFHEDQSCNY LLLHLDHQSG VLPWWD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024382287.10.0homeobox-leucine zipper protein HOX20-like
RefseqXP_024382288.10.0homeobox-leucine zipper protein HOX20-like
RefseqXP_024382290.10.0homeobox-leucine zipper protein HOX20-like
TrEMBLA0A2K1K5M00.0A0A2K1K5M0_PHYPA; Uncharacterized protein
STRINGPP1S325_51V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.16e-39HD-ZIP family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]