PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c8_21660V3.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 325aa    MW: 35494.6 Da    PI: 7.3242
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c8_21660V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.78.3e-43101101101
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        aCaaCk++rrkC++dC+l+pyfp +qpk+f+nvhklFG+sn+l++lk++++++red+++s++yeA+ r +dPv+G++gvi+ lq+q+++lk 
  Pp3c8_21660V3.4.p  10 ACAACKYQRRKCTSDCPLSPYFPPDQPKRFQNVHKLFGVSNILRILKHVDPSKREDTVKSIAYEADTREKDPVHGCLGVITILQNQVSKLKD 101
                        7******************************************************************************************* PP

             DUF260  93 elallkeel 101
                        ela+++e+l
  Pp3c8_21660V3.4.p 102 ELAVVREQL 110
                        ****99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4269110IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-4110107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MTGSGSTNTA CAACKYQRRK CTSDCPLSPY FPPDQPKRFQ NVHKLFGVSN ILRILKHVDP  60
SKREDTVKSI AYEADTREKD PVHGCLGVIT ILQNQVSKLK DELAVVREQL YLLQQQHNFN  120
QQAQVQQIVG SLGGNTSVVN VSSGQETNVL IQQLQEYNGM NHLSSDFAKS NLLSISCFES  180
DQYLRNDKYD IKSASSSRFD VGRYISGDSP VQQSVLLGSG GPVKESPVHQ SEPPRGANVF  240
NGYGMADPGS TFTDTSGDHR ILQDVDHAFA TPDPYAMAIR RRGSGLLNLT IASDAELRRA  300
TGGHHGVPEH ELKSAGVYLT LTNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-361111012111LOB family transfactor Ramosa2.1
5ly0_B4e-361111012111LOB family transfactor Ramosa2.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024383295.10.0LOB domain-containing protein 33-like isoform X1
TrEMBLA0A2K1K8970.0A0A2K1K897_PHYPA; Uncharacterized protein
STRINGPP1S9_450V6.11e-174(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.15e-42LOB domain-containing protein 25