PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c7_9970V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family EIL
Protein Properties Length: 680aa    MW: 73453.9 Da    PI: 5.011
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c7_9970V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3465.83.1e-142444561353
                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaa................tgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgii 77 
                       +el+krmw+d+m+lkr+ke +k++   ++ +                ++ak++++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgii
  Pp3c7_9970V3.2.p  44 DELEKRMWRDKMRLKRIKELQKDRE-MRSGTgvdgksggggvgergvASAKQHKQSQEQARRKKMSRAQDGILKYMLKMMEVCQAQGFVYGII 135
                       79*****************999853.4444457888899999999988888889*************************************** PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HH CS
              EIN3  78 pekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvep 170
                       pekgkpv+gasd++raWWkekv+fdrngpaai+kyqa+++++++ +++ ++   ++h+l+elqDTtlgSLLsalmqhcdppqrr+plekgv+p
  Pp3c7_9970V3.2.p 136 PEKGKPVSGASDNIRAWWKEKVRFDRNGPAAIVKYQADHALPGKPKGN-VSTGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRYPLEKGVPP 227
                       *****************************************9988887.669***************************************** PP

                       HH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX CS
              EIN3 171 PWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah 263
                       PWWP+G+e+ww++lgl+k qg+ppykkphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++lsvlnqee ++++ s  
  Pp3c7_9970V3.2.p 228 PWWPSGDEEWWPQLGLPKGQGAPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLSVLNQEEGLARQQSGA 320
                       ***************************************************************************************999988 PP

                       ..XX..XXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX............................................XXXXXX CS
              EIN3 264 ..ss..slrkqspkvtlsceqkedvegkkeskikhvqavktta............................................gfpvvr 308
                         s      ++   +  +++++ dv+g ++s    + +++ ++                                            ++   +
  Pp3c7_9970V3.2.p 321 ggSAgtPGGQNGSGLAGNSSNEFDVDGVDDSPPGPSGSDEGQDvdtddyepcagsrpahsaakggadrdtdsldstfdksslrpqdgDLVDGS 413
                       653344333455566777777788885555544444444444456667999**********************************87666666 PP

                       XXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
              EIN3 309 krkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                       ++k+ ++e ++++++  +++c   +++++e +  f d++ ++ ++
  Pp3c7_9970V3.2.p 414 RKKRSSGEVQSMEQR--VYMCPYPNCKRNEWRSAFVDRELRNMHQ 456
                       666677777777655..7************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.5E-12944311No hitNo description
Gene3DG3DSA:1.10.3180.102.8E-74186317IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167688.24E-62190314IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 680 aa     Download sequence    Send to blast
MERGEEVEYG GTMEMGDFLS ENDDGEGLMM QDGEEMSDEE MDVDELEKRM WRDKMRLKRI  60
KELQKDREMR SGTGVDGKSG GGGVGERGVA SAKQHKQSQE QARRKKMSRA QDGILKYMLK  120
MMEVCQAQGF VYGIIPEKGK PVSGASDNIR AWWKEKVRFD RNGPAAIVKY QADHALPGKP  180
KGNVSTGPTP HTLQELQDTT LGSLLSALMQ HCDPPQRRYP LEKGVPPPWW PSGDEEWWPQ  240
LGLPKGQGAP PYKKPHDLKK AWKVGVLTAV IKHMSPDIAK IRKLVRQSKC LQDKMTAKES  300
ATWLSVLNQE EGLARQQSGA GGSAGTPGGQ NGSGLAGNSS NEFDVDGVDD SPPGPSGSDE  360
GQDVDTDDYE PCAGSRPAHS AAKGGADRDT DSLDSTFDKS SLRPQDGDLV DGSRKKRSSG  420
EVQSMEQRVY MCPYPNCKRN EWRSAFVDRE LRNMHQASCV FRPVASVSVN NIMYSGNTQP  480
QGLSGKGLFQ IGGMVGNPGG VIQGAAGYAP LPLPVPIQNM SSVPNMQGGN GDQQPLHDLL  540
AGLYGANGMH PVEGSMGVAR SSGLDGSELC NGLLAIDNGM ANQSQRQMDS SDLVADETMF  600
GQGFGEGSNV TDVSMENHGS LPKDGKVFEH SFDPHSGVEP PLDYNFSSTF DIGIESHVPL  660
GPSAIDHLLG EDPIWYFGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-781893162129Protein ETHYLENE INSENSITIVE 3
4zds_B1e-781893162129Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotO246061e-157EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0C9RQ590.0A0A0C9RQ59_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_3637_3249 transcribed RNA sequence
STRINGPP1S87_38V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.11e-141EIL family protein