PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c7_940V3.3.p
Common NameGRS3, PHYPADRAFT_235430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 550aa    MW: 60787.1 Da    PI: 6.6275
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c7_940V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS444.85.9e-136635481374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lLl+cA+av+++++e ++a+L+++s las +gdpmqR+a+yf+e+Laar+++s+++lykal++++ +  ++ + ++a+++f+ v+P++kf+
  Pp3c7_940V3.3.p  63 LIHLLLACAHAVANNNMEYTNAYLEQISVLASLTGDPMQRVATYFMEGLAARITKSWPGLYKALHSTHLP--SVMDIISARQVFFSVCPYVKFA 154
                      689*************************************************************999998..59******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrled 188
                      +l+ NqaIl+a+ege+ vHi+D+++s ++QW+aLl++L+ R+egpp+lRiTgv+     +k+ le+tg+rL++ Ae+l++pf+f++l + +le+
  Pp3c7_940V3.3.p 155 FLMGNQAILDAMEGEKVVHIVDLEASDPVQWLALLEELSVRKEGPPHLRITGVSL----KKDVLEQTGQRLSEEAEKLDIPFQFHPL-VASLEK 243
                      *******************************************************....9**************************5.889*** PP

             GRAS 189 leleeLrvkpgEalaVnlvlqlhrll.................................................................... 214
                      l++++L+vk+gEa+a++++++lh ll                                                                    
  Pp3c7_940V3.3.p 244 LDVDSLKVKSGEAVAISSMMRLHPLLaketdavlrtendnhnhpvirhlrsssggyerityvsrdeaintagevgsdrglkrsremyeaapevg 337
                      ********************************************************************************************** PP

             GRAS 215 ...................................................desvsles.....erdevLklvkslsPkvvvvveqeadhnses 252
                                                                         +     es       +++L+ ++ lsPkv+v+veq+++hns+s
  Pp3c7_940V3.3.p 338 aetlknhvdaseagvrqqlprsmslsdgngtnvesrgkpsmvhlprdesscS-----ESgfgsgVVQRILQKLQCLSPKVMVLVEQDSNHNSGS 426
                      **********************************************555544.....4444444899*************************** PP

             GRAS 253 FlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                        erf+eal+yysa+fdsl+ +lp++  er+++E++llg+ei+n+vacegaer+erhe+  +Wr+r+++aGF + pls++aa qak+ll+ ++ 
  Pp3c7_940V3.3.p 427 MPERFVEALHYYSAVFDSLNLTLPQHCLERVTLEKFLLGQEIKNIVACEGAERVERHEKIDRWRMRMRSAGFVSRPLSSTAALQAKRLLHGYPC 520
                      ********************************************************************************************** PP

             GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaWr 374
                      dgyrv++++g+l+l+W+d +L+++SaW+
  Pp3c7_940V3.3.p 521 DGYRVKDDQGCLTLCWQDTTLYTASAWT 548
                      ***************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.9237528IPR005202Transcription factor GRAS
PfamPF035142.0E-13363548IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MPGMIKGETS NSISHSPSLS VSTTSFSSLS HVSGHQSSPS TASTPAQLTW LQDLRSEERG  60
LYLIHLLLAC AHAVANNNME YTNAYLEQIS VLASLTGDPM QRVATYFMEG LAARITKSWP  120
GLYKALHSTH LPSVMDIISA RQVFFSVCPY VKFAFLMGNQ AILDAMEGEK VVHIVDLEAS  180
DPVQWLALLE ELSVRKEGPP HLRITGVSLK KDVLEQTGQR LSEEAEKLDI PFQFHPLVAS  240
LEKLDVDSLK VKSGEAVAIS SMMRLHPLLA KETDAVLRTE NDNHNHPVIR HLRSSSGGYE  300
RITYVSRDEA INTAGEVGSD RGLKRSREMY EAAPEVGAET LKNHVDASEA GVRQQLPRSM  360
SLSDGNGTNV ESRGKPSMVH LPRDESSCSE SGFGSGVVQR ILQKLQCLSP KVMVLVEQDS  420
NHNSGSMPER FVEALHYYSA VFDSLNLTLP QHCLERVTLE KFLLGQEIKN IVACEGAERV  480
ERHEKIDRWR MRMRSAGFVS RPLSSTAALQ AKRLLHGYPC DGYRVKDDQG CLTLCWQDTT  540
LYTASAWTV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-435554811379Protein SCARECROW
5b3h_A2e-435554810378Protein SCARECROW
5b3h_D2e-435554810378Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.9190.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024381004.10.0scarecrow-like protein 3
RefseqXP_024381005.10.0scarecrow-like protein 3
RefseqXP_024381006.10.0scarecrow-like protein 3
TrEMBLA0A2K1K9U30.0A0A2K1K9U3_PHYPA; Uncharacterized protein
STRINGPP1S130_153V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.13e-87scarecrow-like 3
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]