PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c7_26690V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family B3
Protein Properties Length: 1538aa    MW: 171376 Da    PI: 8.463
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c7_26690V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.33.5e-10531291497
                        T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                 B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                        g ++lp +f+e+hg  ++ +  +tl+ +sg + +  +  ++ ++++ + +GWk+Fv  +++ +gD vv +l+ +s+f   vk++
  Pp3c7_26690V3.1.p  53 GFVRLPSSFMEQHG--PRIGNVVTLKGPSGWVGQASV--SN-DEGFAFCGGWKQFVVHHNIGAGDYVVCTLIADSKF--SVKIY 129
                        5579*********8..568889********9999999..55.56778888**********************99999..88776 PP

2B349.57.9e-163193991599
                        -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                        + +++  fa++    +ee  +l l d   ++W v++    + +++vl++GW +Fv++n+L+ gD+vvF+l++ ++ +l+v++fr 
  Pp3c7_26690V3.1.p 319 QSYFSSVFARKWF--PEERAQLLLIDDADNKWAVTF--IPTASHMVLGAGWAKFVRDNKLEKGDVVVFELKNPNTLTLTVHIFRV 399
                        5555666777765..33455799*************..999999*************************9888**********95 PP

3B342.61.1e-137378023198
                        .--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                 B3  31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                         e+++ tl d++g++W  k  ++ +++r  l++GWk+F+ ++ L+egD++vF++++r + +l++ +fr
  Pp3c7_26690V3.1.p 737 DETRDATLVDSTGQTWMCKWLVNHSGRR--LSAGWKRFAVDHLLEEGDVCVFEMIDRINLTLLINIFR 802
                        355689**************77777766..9************************9999999999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.9E-1636131IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.22E-1737139IPR015300DNA-binding pseudobarrel domain
CDDcd100172.82E-1337130No hitNo description
SMARTSM010191.0E-639132IPR003340B3 DNA binding domain
PROSITE profilePS508638.89640132IPR003340B3 DNA binding domain
PfamPF023622.3E-753130IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-18298398IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-17300400IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.408305400IPR003340B3 DNA binding domain
SMARTSM010191.2E-9311400IPR003340B3 DNA binding domain
PfamPF023623.5E-13315399IPR003340B3 DNA binding domain
CDDcd100171.19E-15321398No hitNo description
Gene3DG3DSA:2.40.330.109.3E-16706798IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.65E-15708798IPR015300DNA-binding pseudobarrel domain
CDDcd100172.54E-17711802No hitNo description
SMARTSM010190.001713804IPR003340B3 DNA binding domain
PfamPF023621.9E-11731802IPR003340B3 DNA binding domain
PROSITE profilePS5086311.364738804IPR003340B3 DNA binding domain
SuperFamilySSF1019367.46E-159061008IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-139061008IPR015300DNA-binding pseudobarrel domain
CDDcd100172.86E-149111008No hitNo description
PROSITE profilePS508637.9239131010IPR003340B3 DNA binding domain
SMARTSM010190.0159131010IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1538 aa     Download sequence    Send to blast
MKTDLEGLRP CASFTETCVE SHGAQCQLNE DQSVGAPSFL KMIRDKHLPN NAGFVRLPSS  60
FMEQHGPRIG NVVTLKGPSG WVGQASVSND EGFAFCGGWK QFVVHHNIGA GDYVVCTLIA  120
DSKFSVKIYN KFGCEKDHPS HALTPEGPKV HLSIFKPSEG GREFSLTNLG GKRKTLDEVK  180
SLSGIGKKLC MQQLGLERSI VEEGNAEIET KLHIASEFKS DHDPDPQQSV DTVRASTPVQ  240
VGPLSEDYSS SESEKRNVEM EEIDDIDDCN KAIVRKRAHR AVYETEMRRF MAMEAAQAYE  300
TANPRTMLVV NKTAITKSQS YFSSVFARKW FPEERAQLLL IDDADNKWAV TFIPTASHMV  360
LGAGWAKFVR DNKLEKGDVV VFELKNPNTL TLTVHIFRVK DYTFVRVANL GRTKHPDSSM  420
VSTPSKTDNL SGNARVKHTA ESREDNQSPG TSDITELKSQ SPMAPQYAAV AKYFANRASP  480
SIYGNQKVCD GVVQESEPQK ANETNSTAEE CGIIRHIGES FTISKQGLHF LMPGSQSRER  540
EETLVELNDK ISAYSTQKNL QTAAPFTALP SGISEIQCFY SPATHSPQQL QSLLAQQEQI  600
ADGMPAHLGG TVFLAPQGQK PCSTQVQDRT TIMNLQPNQP LETSQLDESH TGVTVPPGLP  660
KEVEFPRIMK DDPPARPRER WEIKPRRPRP PTDAERQRAM DEASEFWTPN PHVMVVLKPS  720
QVYAGFSLTL RCAALPDETR DATLVDSTGQ TWMCKWLVNH SGRRLSAGWK RFAVDHLLEE  780
GDVCVFEMID RINLTLLINI FRIELDDHIS EPIEIRKSVE LRRPPADPTK RKRKSRAKPK  840
GLGPPVPKLP AYSGCRMEKL GGSSPLPRGA NVLPNMPSYK YTALQSRRRP VTMEERRRTE  900
LGARNLNTKN PSVTVVMRNS SVYCHFLVSI PSAFAKQWLP RKLVRVTLVD SGGQKSTARW  960
AGNRKKSACL KSFREFSLSH CLEEGDALVF ELMDPNPNNP VFLVHVFRVV ELPSTRMSPK  1020
DWETHYKLDV MIGTMKPVVP LQAYQRRYDG QSRMLQANQP LSSGSEDEQD EPSGVSLQPP  1080
MLSELSPKSK TKAIYSALVK RKTIGNKENG YSDPVQHDLG EDTSSTVEKL AHTAQGQIEN  1140
YADKATHIFQ LERLGRQQIS RDIMPIFKKN PRIDADGPEA VIAGLSNQAC REQVEHVHDK  1200
PDSKAGFHAS HVADDTSQNA KNVKPMVPKT PKKEPLEEVG PPKEGKKTRR KTTQRREGRD  1260
DFLQVAVGET SNWEPQDLNL SRQENIEISD VLRKTLLGSE PKNGVSQPLV PSTHELELLL  1320
DSNASRPDPL SRTKDLQDNK RFISGSNYQD QTGMHGTEHS VRNQKVSIAA DQQTLDRVGA  1380
VENEQWLKPK PEPVHGGDIV RGMRCEGGSC VESGQLEVPR PGKEKGGLVK VDTTTQFKQV  1440
FFGSIIDGVR SEVGAHNSDA ERKRLCHVEQ GLTPKTRDRV DRWQFLQPGM VVNSNADKNV  1500
QASNNNNNRI SWFNHPSIVS QAGKAQASAT WEKRREK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024381077.10.0uncharacterized protein LOC112284923
RefseqXP_024381078.10.0uncharacterized protein LOC112284923
RefseqXP_024381079.10.0uncharacterized protein LOC112284923
TrEMBLA0A2K1KD750.0A0A2K1KD75_PHYPA; Uncharacterized protein
STRINGPP1S97_269V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20511436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49480.17e-14related to vernalization1 1