PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c7_2100V3.1.p
Common NamePHYPADRAFT_154583
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 346aa    MW: 38295.6 Da    PI: 4.5307
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c7_2100V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.41e-1789142356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t +q++ Le  Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  Pp3c7_2100V3.1.p  89 KKRRLTFDQVRSLELNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWK 142
                       45578999*********************************************9 PP

2HD-ZIP_I/II120.68.3e-3988179192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       ekkrrl+ +qv++LE +Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+ktkqlE+dye+L   y++lk+e e++ +e++eL+ e++
  Pp3c7_2100V3.1.p  88 EKKRRLTFDQVRSLELNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWKTKQLERDYEVLTLDYNRLKSEFEAVLQEKQELQGEME 179
                       69*************************************************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.77E-1980146IPR009057Homeodomain-like
PROSITE profilePS5007117.0784144IPR001356Homeobox domain
SMARTSM003899.8E-1487148IPR001356Homeobox domain
CDDcd000861.97E-1589145No hitNo description
PfamPF000465.5E-1589142IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.4E-1991151IPR009057Homeodomain-like
PRINTSPR000316.2E-6115124IPR000047Helix-turn-helix motif
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
PRINTSPR000316.2E-6124140IPR000047Helix-turn-helix motif
PfamPF021831.2E-14144186IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MASNVGRGGY SRGGSNVVPV RNDSSTDTLV AMLASCSPVA LQVQRTGGSL EDAVVSCGQK  60
RSFFPLFEAS REDAGDEDLG DDCTHNVEKK RRLTFDQVRS LELNFEVENK LEPERKMQLA  120
KELGLQPRQV AVWFQNRRAR WKTKQLERDY EVLTLDYNRL KSEFEAVLQE KQELQGEMEC  180
LTGRLQTSPQ LASGDGVSEK PSKKSSKAVA SQLSLQKMVS EECVKLESKP QDPNDSSNDD  240
KEEGSRATSS DSISSGILDA DSPLTTEMIT TTTLPHISIH VAAEMPLSSN IINMSDNLCN  300
QMLSPHACQQ ISVKLEDGSS QDESSSNYIL TQLDEERGLP WWDWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136144RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.1610.0gametophore| sporophyte
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0280730.0AB028073.1 Physcomitrella patens mRNA for homeobox protein PpHB2, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024379939.10.0homeobox-leucine zipper protein HAT5-like isoform X1
TrEMBLA0A2K1KA000.0A0A2K1KA00_PHYPA; Uncharacterized protein
STRINGPP1S431_27V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.13e-40HD-ZIP family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]