PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c7_1530V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 644aa    MW: 70987.1 Da    PI: 5.1967
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c7_1530V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS371.98.5e-1142786421374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       lv+ Ll+cAea++++d+++a+ +L +l   + p+gdpmqR+a yf eAL  +la+        ++pset  +  s++  a+++f++v P+ kf
  Pp3c7_1530V3.2.p 278 LVHMLLACAEAIEKSDFNKAKPILDQLLRSSDPYGDPMQRIALYFGEALTDHLAG-------VVSPSET--HLLSDSKLAYQAFYKVLPFAKF 361
                       689****************************************************.......4455555..4799999*************** PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                       sh+taNq+I+eav +++ vH++D+di+ GlQWp+++q+La Rp+g+p+lRi ++g     ++e+l++t++rL++fAe+l+vpfef++ v ++l
  Pp3c7_1530V3.2.p 362 SHVTANQTIYEAVVRSQNVHVVDLDIQLGLQWPCFIQSLAMRPGGAPHLRISAIGT----NAENLQTTKRRLSEFAEALKVPFEFTP-VLSSL 449
                       ********************************************************....99*************************.799** PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       e+l+  +L+++++E la+n++  lh+l  e++ l++    +L+++ +l+P+vv++ e ea+hn++sF +rf+eal+yy alfdsle  l+r+s
  Pp3c7_1530V3.2.p 450 ENLTAAMLDIRSEEDLAINCSQVLHTLSGEEAVLDK----LLSMFHNLKPNVVTLLEAEANHNGASFIARFVEALHYYCALFDSLEGALGRDS 538
                       ***************************987777777....***************************************************** PP

              GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg.........yrveeesgslvlgWk 363
                        +r  +E   l+ ei+++va +g++rr rh + e+Wr  + +aGF ++++s+++++qa++ll+   s+          y++ +es sl+lgW+
  Pp3c7_1530V3.2.p 539 ADRYHIESTALAAEIKEIVAFKGNRRRVRHVRSETWRGLFAKAGFLSMAFSSYTVQQAQMLLEVLTSKPmqqanatmpYKLSQESTSLILGWQ 631
                       **************************************************************9766443233455666888899********* PP

              GRAS 364 drpLvsvSaWr 374
                       + p++ vSaW+
  Pp3c7_1530V3.2.p 632 ETPVIGVSAWT 642
                       **********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.583252613IPR005202Transcription factor GRAS
PfamPF035142.9E-111278642IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MAATHVVSKK RSPTIFSEVA TATCKRWKSE AAWHHVEEMA PEPPPIQDFD LKVKTSCLKM  60
VQPEPTSVLD LQASPGRSCS SSTSLSSGTD SPHSISTDSP NFSTTVQQVE PVDIASWVDC  120
MALPEFEDCD RHLEEVLKSD IDFASTDLDF GFELTSLDHC SVVTEHGYSV SLLSEFLGDP  180
DENLLLPESF HDAKRLQELD DSLSSMLSEV RSSGSDSGSS VPTTVELARL VESLPCSDLR  240
RHGGVDTKHH HHHSRSESWG STSKLQTLQH PEDSGLQLVH MLLACAEAIE KSDFNKAKPI  300
LDQLLRSSDP YGDPMQRIAL YFGEALTDHL AGVVSPSETH LLSDSKLAYQ AFYKVLPFAK  360
FSHVTANQTI YEAVVRSQNV HVVDLDIQLG LQWPCFIQSL AMRPGGAPHL RISAIGTNAE  420
NLQTTKRRLS EFAEALKVPF EFTPVLSSLE NLTAAMLDIR SEEDLAINCS QVLHTLSGEE  480
AVLDKLLSMF HNLKPNVVTL LEAEANHNGA SFIARFVEAL HYYCALFDSL EGALGRDSAD  540
RYHIESTALA AEIKEIVAFK GNRRRVRHVR SETWRGLFAK AGFLSMAFSS YTVQQAQMLL  600
EVLTSKPMQQ ANATMPYKLS QESTSLILGW QETPVIGVSA WTC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A5e-7626964210379Protein SCARECROW
5b3h_A7e-762696429378Protein SCARECROW
5b3h_D7e-762696429378Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.17100.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024380933.10.0DELLA protein RGL1-like
TrEMBLA0A2K1K9W40.0A0A2K1K9W4_PHYPA; Uncharacterized protein
STRINGPP1S130_58V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-76RGA-like 1