PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c7_12680V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family B3
Protein Properties Length: 724aa    MW: 81416.7 Da    PI: 7.1386
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c7_12680V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B330.65.9e-101222031598
                        -EE--HHH.HTT---..--SEEEEEETTS..-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                 B3  15 rlvlpkkfaeehggkkeesktltledesg..rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                          v+pk f++ hg+  ++ k   l  ++   +  ev +    + g++ +++GW+ Fv +n Lk gD+++F+++ +++f  +v+vf+
  Pp3c7_12680V3.1.p 122 EAVIPKAFMDLHGSGLRGCKVADLIGSNRvlQLVEVHV--AATTGAVSFRQGWEVFVTDNYLKPGDSLLFTMVAKNSF--TVRVFS 203
                        469******99965555655666666555555556666..99999**************************9987888..888886 PP

2B345.61.2e-14361454198
                        EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                        f  v++ps+v +  +l++p +f + h+  +++ +t+t++de g +W  +     +s +  l++GW  F +++ L+egD +vF++ + +   l
  Pp3c7_12680V3.1.p 361 FMVVMMPSHVYRGFWLTVPQEFSRLHM--PRKRTTITVQDEFGFQWPGQW--VVNSLHGGLSDGWAAFSRDHYLEEGDACVFEVLNLKIPLL 448
                        7889*******************9998..456679***************..55555556***********************654455556 PP

                        EEEEE- CS
                 B3  93 vvkvfr 98 
                        +v++fr
  Pp3c7_12680V3.1.p 449 LVHIFR 454
                        777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.0E-107188IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0037121205IPR003340B3 DNA binding domain
SuperFamilySSF1019361.53E-10122202IPR015300DNA-binding pseudobarrel domain
PfamPF023621.7E-7122203IPR003340B3 DNA binding domain
CDDcd100173.35E-11124203No hitNo description
Gene3DG3DSA:2.40.330.101.0E-10124203IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.91168205IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-19354454IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.08E-22356457IPR015300DNA-binding pseudobarrel domain
CDDcd100172.16E-20359454No hitNo description
SMARTSM010191.2E-12361456IPR003340B3 DNA binding domain
PROSITE profilePS5086312.647361456IPR003340B3 DNA binding domain
PfamPF023624.3E-13361454IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 724 aa     Download sequence    Send to blast
MQVGAVRSVC KKTCEYFHNR VHSWWSMLER VMDPSTAHTH PAEKSEGSHK ESLPQAAPAS  60
GLGKFDTLST TPLCFLKTVV ENDLRSNFVS SFRFFFNASA CSKDNPFRML IDRWKGSETL  120
FEAVIPKAFM DLHGSGLRGC KVADLIGSNR VLQLVEVHVA ATTGAVSFRQ GWEVFVTDNY  180
LKPGDSLLFT MVAKNSFTVR VFSGVGLESV PHPVNLTSSY TTQDQVLTPE SQSKSTCCKE  240
VEDSEELAFG VEIDGSESCD HEGPGTGCGA TDPGDVNHDH GPSISEILKQ HGYTAERKRD  300
KIGRALRHKR SHHVREGSFA LEPGWNPTEW RSRRRPVTAE ERDRVRAAAL KFESQTKRPS  360
FMVVMMPSHV YRGFWLTVPQ EFSRLHMPRK RTTITVQDEF GFQWPGQWVV NSLHGGLSDG  420
WAAFSRDHYL EEGDACVFEV LNLKIPLLLV HIFRVVEVPL LPGSRGGWDV HYRVVNNISR  480
NKSLGIPLSE GHSLAQELPG DNTVETIGGN SQKTRRSLIE ELQTMVMNDH FSKRRREDFP  540
PRAPGFKARN EACEEDVKPD ITPPEQIQSL WPPDSPVYLS PESMHVKVES RNANQSHTPT  600
SLHASPEVKI EPFVAAEREG ICCEDSLKKG SHISVYTRRR RSDAAPNIAT KPTKSEKDAT  660
VWYRVISIRN RRTVKTEEEF CVEIDHTVPE HGSDYKDVER GPDGLWWVPR SHFEGDYSIC  720
RLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A1e-1633245722144B3 domain-containing transcription factor VRN1
4i1k_B1e-1633245722144B3 domain-containing transcription factor VRN1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K1KBG70.0A0A2K1KBG7_PHYPA; Uncharacterized protein
STRINGPP1S75_174V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20511436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.14e-17B3 family protein