PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c6_27690V3.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 417aa    MW: 46481.9 Da    PI: 6.5671
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c6_27690V3.5.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.91.1e-54181451128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGfrFhPtd+elv++yL +k+++ ++ + ++i++vd++k+ePwdLp k+k +ekewyfFs rd+ky+tg+r+nrat++gyWkatgkd++v
  Pp3c6_27690V3.5.p  18 LPPGFRFHPTDDELVSFYLVRKISNPQVVV-KTIPNVDLNKCEPWDLPDKAKVGEKEWYFFSLRDRKYPTGQRTNRATDKGYWKATGKDRDV 108
                        79*************************998.88***************99999*************************************** PP

                NAM  93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +++ ++ lvg+kktLvfy grapkg kt+W+mheyrl
  Pp3c6_27690V3.5.p 109 MNSgTHCLVGMKKTLVFYMGRAPKGLKTNWIMHEYRL 145
                        **855556***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.76E-6314174IPR003441NAC domain
PROSITE profilePS5100560.01718174IPR003441NAC domain
PfamPF023651.2E-2719145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MCNGKNTIEM QQDSNLELPP GFRFHPTDDE LVSFYLVRKI SNPQVVVKTI PNVDLNKCEP  60
WDLPDKAKVG EKEWYFFSLR DRKYPTGQRT NRATDKGYWK ATGKDRDVMN SGTHCLVGMK  120
KTLVFYMGRA PKGLKTNWIM HEYRLGSDSS NHFNGQQSHR YKNNEWVVCR VFQKTGGSKT  180
LGLSSTDKAS YQPAAHLHYA LPGNHRDSSP NPTVTDSDDG DTCTAAESCH NSQDSYLDAG  240
VYVAQMLTQG DVTSVGAPQW AAPGSVPMAT PVMDIQPHNT MKESYYNHQN GANMSMLFSP  300
PPQNMVSYPL IPHIGNRMRP KQEPFYPTTC AGEDEAESSQ KLNKLDYAWT GDVLNPEYYP  360
CDSPLTPLQS IVGESGQTSS CLTDGNALHN RAFRGSFSGF QEMAGPIELT TQEWAY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B7e-541417413165NAC domain-containing protein 19
4dul_A7e-541417413165NAC domain-containing protein 19
1ut7_B7e-541417413165NO APICAL MERISTEM PROTEIN
1ut7_A7e-541417413165NO APICAL MERISTEM PROTEIN
1ut4_B7e-541417413165NO APICAL MERISTEM PROTEIN
1ut4_A7e-541417413165NO APICAL MERISTEM PROTEIN
3swp_D7e-541417416168NAC domain-containing protein 19
3swp_C7e-541417416168NAC domain-containing protein 19
3swp_B7e-541417416168NAC domain-containing protein 19
3swp_A7e-541417416168NAC domain-containing protein 19
3swm_D7e-541417416168NAC domain-containing protein 19
3swm_C7e-541417416168NAC domain-containing protein 19
3swm_B7e-541417416168NAC domain-containing protein 19
3swm_A7e-541417416168NAC domain-containing protein 19
3ulx_A8e-5491746168Stress-induced transcription factor NAC1
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.72710.0protonema
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00662PBM25215497Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S279_85V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.24e-74NAC domain containing protein 38