PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c6_2730V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 344aa    MW: 38435.1 Da    PI: 4.904
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c6_2730V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.41e-1785138356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t +q++ Le  Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  Pp3c6_2730V3.2.p  85 KKRRLTFDQVRSLEYNFEIENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWK 138
                       45578999*********************************************9 PP

2HD-ZIP_I/II121.83.4e-3984176193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrl+ +qv++LE +Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+ktkqlE+dye+L   y++lk+e +++ +e++eL++++k+
  Pp3c6_2730V3.2.p  84 EKKRRLTFDQVRSLEYNFEIENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWKTKQLERDYEVLNLDYNRLKKEFDAVIQEKQELQDAVKT 176
                       69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-1976142IPR009057Homeodomain-like
PROSITE profilePS5007117.34680140IPR001356Homeobox domain
SMARTSM003895.2E-1383144IPR001356Homeobox domain
CDDcd000861.16E-1585141No hitNo description
PfamPF000464.4E-1585138IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-1987147IPR009057Homeodomain-like
PRINTSPR000316.2E-6111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000316.2E-6120136IPR000047Helix-turn-helix motif
PfamPF021831.0E-12140180IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MASLGRGYGG SNVTLVRNES SNDTFVAMLT SCSPVTLQVQ RADGSLEDAV TSFDKKRPFC  60
AAFEASGEDP AEEEIGDDFT QQVEKKRRLT FDQVRSLEYN FEIENKLEPE RKMQLAKELG  120
LQPRQVAVWF QNRRARWKTK QLERDYEVLN LDYNRLKKEF DAVIQEKQEL QDAVKTLKEK  180
SPMPQPSPAG NPQEKLKKPK TATQPSPPRT SEAPVKLERT SAAHKARNGD LTRPHVGAGL  240
RVTFSSDSLS SEILNADSPH TTSDSVSLPS LDQITTDGLI SGNSMVDSSI MDMSDSICDQ  300
ILSPLACQRV SVKLEEGSCQ DDSCNYILSH LYEEKCVPWW DWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132140RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.130850.0gametophore
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024377129.10.0homeobox-leucine zipper protein HOX25-like
TrEMBLA0A2K1KE350.0A0A2K1KE35_PHYPA; Uncharacterized protein
STRINGPP1S77_184V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-40HD-ZIP family protein