PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c6_26790V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 319aa    MW: 34479.1 Da    PI: 5.9738
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c6_26790V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26057.15.2e-185683396
             DUF260 33 vhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96
                       v+k+FG++ ++ +++a++e+er+++++sl+yeA+ r+ +Pv Ga+g+++++++q++q++++++l
  Pp3c6_26790V3.1.p  5 VAKFFGRAGLMGFISAVSENERSALFQSLLYEACERTVNPVLGAMGLLWSGNWQICQAAVDTVL 68
                       89********************************************************998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.941173IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-13566IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MPVLVAKFFG RAGLMGFISA VSENERSALF QSLLYEACER TVNPVLGAMG LLWSGNWQIC  60
QAAVDTVLKG GLIRPPPRPN YTTPCFPALD MCGNSSIPSA EGVDDLTQIT LSSNASVMSS  120
LDTRTMSPGI GLPEANYQES KEFPSSIRDK ANNSGQHLEA VVPQNAEPNF ICQEHRQCDS  180
WTQSKSDREF HKDELGHEFF ELKKRTTGAF VASRRVRARV EASPPAPIRS GGGVHEDLLV  240
PAHGDEQLEL DLNLKVKGEK GGRLMGNTRL SSPCESVNSQ GSVTSLDSAL REPLKPLNGA  300
LGVQFLPSPY CTLLPLLQ*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024377389.10.0LOW QUALITY PROTEIN: LOB domain-containing protein 41-like
TrEMBLA0A2K1KHA90.0A0A2K1KHA9_PHYPA; Uncharacterized protein
STRINGPP1S53_1V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4031699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67420.14e-35LOB domain-containing protein 37