PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c6_16410V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 450aa    MW: 50759.9 Da    PI: 5.9609
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c6_16410V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS394.89.4e-121734441373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPil 91 
                        l++ L++ A+ +s+ d e+a+ lL+ l+ ++s++gd+ +R+a++f eALa+r +r s++e+ + l++ +t+e +s+e l+a+ ++++v+P++
  Pp3c6_16410V3.1.p  73 LRDILVDTAQYISQCDWERARPLLQVLRRQVSSTGDSSERVASCFFEALATRFSRvSGTEINELLSS-PTQEPSSEEILSAFLALNQVTPFM 163
                        5789***************************************************777777776644.4445679999999999******** PP

               GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp....egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                        +f+hltaNqa+lea+ ge+ vHi+D+di++G+QWp+++qaLa+ +    +   +lRiTgvg+    ++e+l +tg rLa+fA+++++pfef+
  Pp3c6_16410V3.1.p 164 RFAHLTANQALLEALTGEDFVHIVDLDIGHGVQWPPFMQALADIRgeegHTIQHLRITGVGK----DREMLDRTGTRLAEFAQSIQLPFEFT 251
                        ******************************************65535333356*********....************************** PP

               GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                        +l +++ e+l ++++ ++ gEa+a n++lqlh+ll+   + +++ +++L ++ sl P+vv+++e ea+hn++ Fl+rf+eal++ys+lfdsl
  Pp3c6_16410V3.1.p 252 PL-VQAPENLIPSMFGLRIGEAVAFNCMLQLHQLLA---KGSEKLTSFLYMLESLTPRVVTLAELEASHNQPHFLDRFAEALNHYSTLFDSL 339
                        *5.88999999************************4...33344679********************************************* PP

               GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveee..sgslvl 360
                        +a+lp++s eri vE+ + + ei n+vac g+er+ rh++ e+Wr+ +e+aGF+ +p s +a++qa+lllr ++  dgyr+ e+  +g+l+l
  Pp3c6_16410V3.1.p 340 DATLPPTSPERIRVEQTWYKMEIINIVACDGTERTVRHQRCEQWRRFFERAGFQLLPTSRFATSQARLLLRLHYpCDGYRLVEDveDGCLLL 431
                        **********************************************************************************8777****** PP

               GRAS 361 gWkdrpLvsvSaW 373
                        gW+drpL+ vS+W
  Pp3c6_16410V3.1.p 432 GWQDRPLFCVSSW 444
                        ************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.6547422IPR005202Transcription factor GRAS
PfamPF035143.2E-11873444IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010223Biological Processsecondary shoot formation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MQLFVPPLRM RVHSHNFSRP QLSLRFPGGL HEMLGSVGSN ASASSEPVPE VSSPHRTYGY  60
VDCSNSLGGL MLLRDILVDT AQYISQCDWE RARPLLQVLR RQVSSTGDSS ERVASCFFEA  120
LATRFSRVSG TEINELLSSP TQEPSSEEIL SAFLALNQVT PFMRFAHLTA NQALLEALTG  180
EDFVHIVDLD IGHGVQWPPF MQALADIRGE EGHTIQHLRI TGVGKDREML DRTGTRLAEF  240
AQSIQLPFEF TPLVQAPENL IPSMFGLRIG EAVAFNCMLQ LHQLLAKGSE KLTSFLYMLE  300
SLTPRVVTLA ELEASHNQPH FLDRFAEALN HYSTLFDSLD ATLPPTSPER IRVEQTWYKM  360
EIINIVACDG TERTVRHQRC EQWRRFFERA GFQLLPTSRF ATSQARLLLR LHYPCDGYRL  420
VEDVEDGCLL LGWQDRPLFC VSSWHPSNM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-688144627380Protein SCARECROW
5b3h_A2e-688144626379Protein SCARECROW
5b3h_D2e-688144626379Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024377672.10.0scarecrow-like protein 18
RefseqXP_024377674.10.0scarecrow-like protein 18
RefseqXP_024377675.10.0scarecrow-like protein 18
RefseqXP_024377676.10.0scarecrow-like protein 18
RefseqXP_024377677.10.0scarecrow-like protein 18
TrEMBLA0A2K1KFX50.0A0A2K1KFX5_PHYPA; Uncharacterized protein
STRINGPP1S240_118V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP54911421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.16e-97GRAS family protein