PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c6_14410V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family CO-like
Protein Properties Length: 554aa    MW: 60075.6 Da    PI: 5.3652
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c6_14410V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.55e-07244339
           zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                       e++C+ ++e +++ +C+ ++ llC +C  + H+       H++
  Pp3c6_14410V3.1.p  2 ETMCDFCGEGQATVYCRADSALLCLSCDRHVHSAnalsqrHSR 44
                       679******77*********************65677777765 PP

2zf-B_box19.81.7e-064686438
           zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                         C  ++  ++   C++Cq+++C++C + +H++      H+
  Pp3c6_14410V3.1.p 46 LLCHGCNIRPAVVRCTTCQSCFCQTCDDDTHNSsvisaqHQ 86
                       57*****************************8777777765 PP

3CCT61.42.9e-21496539144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        R+ a+lRYkeKrk+R+F+K++rYesRKa+A+ R+RvKGrFvk+ 
  Pp3c6_14410V3.1.p 496 RDSAMLRYKEKRKNRRFDKRVRYESRKARADIRKRVKGRFVKAG 539
                        899**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.267147IPR000315B-box-type zinc finger
SMARTSM003362.2E-11147IPR000315B-box-type zinc finger
PfamPF006431.4E-5244IPR000315B-box-type zinc finger
CDDcd000213.04E-9347No hitNo description
PROSITE profilePS501198.7314390IPR000315B-box-type zinc finger
CDDcd000210.003264776No hitNo description
PROSITE profilePS5101715.448496538IPR010402CCT domain
PfamPF062037.5E-16496538IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005886Cellular Componentplasma membrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
METMCDFCGE GQATVYCRAD SALLCLSCDR HVHSANALSQ RHSRTLLCHG CNIRPAVVRC  60
TTCQSCFCQT CDDDTHNSSV ISAQHQRHVL ECFTGCPSAT ELAALWACDD RSDVGATIAS  120
DSPRGLNSQW GGISGSTPTR STAVRENQMS RALRVESSSG IAGVINMSSV VPPPLAKSSV  180
LTSNPEVGQQ EQVSAEKGIS QQLQVLQVQD LSRPSPASLS DQQAKRQCME TQTSIQKQQE  240
SEQCSPIPVR VHSDQQSAQN SQGESSTVVG DGQSMKLEIG PNDIVNQGGT DSFWRSNALT  300
QATQMWGQNM QDLGVCGDVA DPCDDFSMAD VDLFFDNYEE MFSSGTAPSG STFEEMSPRR  360
SSLGQDAANG SNEHARMQSI PEAELFKPIN QGTASTANDI KFREDMVRPA GPGPGPPELH  420
DMEVLMAMND MDGTSCNMGS QFSARPALIS RSLTFSGRSG DSGDYQDCNA SPLFFSSGEA  480
SLGSRSPDSI SITQARDSAM LRYKEKRKNR RFDKRVRYES RKARADIRKR VKGRFVKAGQ  540
AYDYDPLATT RSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.62480.0gametophore| protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024377840.10.0zinc finger protein CONSTANS-LIKE 10-like
RefseqXP_024377841.10.0zinc finger protein CONSTANS-LIKE 10-like
RefseqXP_024377842.10.0zinc finger protein CONSTANS-LIKE 10-like
RefseqXP_024377843.10.0zinc finger protein CONSTANS-LIKE 10-like
RefseqXP_024377844.10.0zinc finger protein CONSTANS-LIKE 10-like
TrEMBLA0A2K1KFK30.0A0A2K1KFK3_PHYPA; Uncharacterized protein
STRINGPP1S195_82V6.30.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.45e-32CONSTANS-like 9