PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c6_13360V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 399aa    MW: 43201.1 Da    PI: 7.3398
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c6_13360V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.74.6e-3755112461
             zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        k ++cprC+s+ntkfCyynnys++qPr+fC++C+ryWt GG+lrnvPvGgg+rk+ ++
  Pp3c6_13360V3.1.p  55 KVIPCPRCQSMNTKFCYYNNYSVNQPRHFCRNCQRYWTVGGTLRNVPVGGGSRKKIRT 112
                        6789**************************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-2452108IPR003851Zinc finger, Dof-type
PfamPF027014.1E-3256109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.35157111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MHLPVNHQIL LGDFEDDSNE ELDARIASSG SGSGGGDSPG SSRGNGGCIR SRPVKVIPCP  60
RCQSMNTKFC YYNNYSVNQP RHFCRNCQRY WTVGGTLRNV PVGGGSRKKI RTRNRNDTYL  120
LGGTPQTSPV GSLFGSGGDL LSSSACMQQL SMLPPTGGML GFGNQTSGFA PAVPPLPYLQ  180
FALEYTQGLH PSVQKPLAGL QEVPDIQSLY DTQASQAPQV NSSIFNSSSS LMLNSGVTLP  240
TLHAPSHSDT LPSVMAKTGL WTVAAQQLPS LNGTTQVQSS WQDKQSKPSM SSQLQHRSGY  300
VERMNPINHM NAIMFPHNVK PGSWEAALMH SRPVMNDRLV PHTSWDENQS STHTNLSPNA  360
SSTTDDERCP SNNCFPHTYE DVSQSWVDLQ ASDALSFQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024377387.10.0dof zinc finger protein DOF2.5-like
TrEMBLA0A2K1KFI30.0A0A2K1KFI3_PHYPA; Uncharacterized protein
STRINGPP1S177_76V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.14e-31Dof family protein