PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c6_1310V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 470aa    MW: 53082.1 Da    PI: 6.7036
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c6_1310V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.71e-48431772128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpk......kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                       p+GfrFhPtdeelv  yL+++v++ +     + +++i+e+d+yk+ePwdL +       ++ ++++wyfFs++dkky+tg+r+nratk+g+Wk
  Pp3c6_1310V3.3.p  43 PVGFRFHPTDEELVGWYLHNRVTAPPpeprEDDQRIIRELDLYKHEPWDLAEvckipgDHSVNQNNWYFFSHKDKKYPTGNRANRATKAGFWK 135
                       89*********************9997765444468**************854656654444788**************************** PP

               NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       atg+dk + +  +  vg++ktLvfykgrap+g+ktdW+mhe+rl
  Pp3c6_1310V3.3.p 136 ATGRDKCIQT--RYSVGMRKTLVFYKGRAPHGQKTDWIMHEFRL 177
                       ********98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-5239201IPR003441NAC domain
PROSITE profilePS5100553.75142201IPR003441NAC domain
PfamPF023654.9E-2643177IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MHCLMISYFA NAADRATPLK SVAPYQVDKM SYNNNNSSNV AIPVGFRFHP TDEELVGWYL  60
HNRVTAPPPE PREDDQRIIR ELDLYKHEPW DLAEVCKIPG DHSVNQNNWY FFSHKDKKYP  120
TGNRANRATK AGFWKATGRD KCIQTRYSVG MRKTLVFYKG RAPHGQKTDW IMHEFRLDDG  180
NQAFRGFDEA GAWVVCRVFR KTKNIKTKGD DTPSTSMEED QHIALQPDIT DSPEKFSSDG  240
GEDGRDVDYP PTNMVPNHIA NYDMHCKQEL FPVNEFRNLH HNLPVHLDNH GIEAILPQSV  300
APHSLFRITA ASTRSNYSAI HLPSSDFDQQ MLQHMGTGSS AAGLFSPMPN NAYHAIIDDH  360
PPRPHIRGMG YRNSSEILNG LAEFQSFGHP ALQGDQTLTD VVSRPLERLQ QLQQSTSDLL  420
STNSVHDVIH NFGMPSLSWQ ARPQSHFVEF CTNPDSINSH SSTFLSSGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B8e-403820113165NAC domain-containing protein 19
4dul_A8e-403820113165NAC domain-containing protein 19
1ut7_B8e-403820113165NO APICAL MERISTEM PROTEIN
1ut7_A8e-403820113165NO APICAL MERISTEM PROTEIN
1ut4_B8e-403820113165NO APICAL MERISTEM PROTEIN
1ut4_A8e-403820113165NO APICAL MERISTEM PROTEIN
3swp_D8e-403820116168NAC domain-containing protein 19
3swp_C8e-403820116168NAC domain-containing protein 19
3swp_B8e-403820116168NAC domain-containing protein 19
3swp_A8e-403820116168NAC domain-containing protein 19
3swm_D8e-403820116168NAC domain-containing protein 19
3swm_C8e-403820116168NAC domain-containing protein 19
3swm_B8e-403820116168NAC domain-containing protein 19
3swm_A8e-403820116168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8980840.0AB898084.1 Physcomitrella patens PpVNS4 mRNA for NAC transcription factor PpVNS4, complete cds, ecotype: Gransden 2004.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001765526.10.0predicted protein
TrEMBLX5IXP80.0X5IXP8_PHYPA; NAC transcription factor PpVNS4
STRINGPP1S77_42V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.14e-67NAC domain containing protein 70