PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c6_1310V3.2.p
Common NamePpVNS4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 463aa    MW: 52415.3 Da    PI: 6.8475
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c6_1310V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.79.8e-49361702128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpk......kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                       p+GfrFhPtdeelv  yL+++v++ +     + +++i+e+d+yk+ePwdL +       ++ ++++wyfFs++dkky+tg+r+nratk+g+Wk
  Pp3c6_1310V3.2.p  36 PVGFRFHPTDEELVGWYLHNRVTAPPpeprEDDQRIIRELDLYKHEPWDLAEvckipgDHSVNQNNWYFFSHKDKKYPTGNRANRATKAGFWK 128
                       89*********************9997765444468**************854656654444788**************************** PP

               NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       atg+dk + +  +  vg++ktLvfykgrap+g+ktdW+mhe+rl
  Pp3c6_1310V3.2.p 129 ATGRDKCIQT--RYSVGMRKTLVFYKGRAPHGQKTDWIMHEFRL 170
                       ********98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-5232194IPR003441NAC domain
PROSITE profilePS5100553.75135194IPR003441NAC domain
PfamPF023654.8E-2636170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MRFSHKDRAT PLKSVAPYQV DKMSYNNNNS SNVAIPVGFR FHPTDEELVG WYLHNRVTAP  60
PPEPREDDQR IIRELDLYKH EPWDLAEVCK IPGDHSVNQN NWYFFSHKDK KYPTGNRANR  120
ATKAGFWKAT GRDKCIQTRY SVGMRKTLVF YKGRAPHGQK TDWIMHEFRL DDGNQAFRGF  180
DEAGAWVVCR VFRKTKNIKT KGDDTPSTSM EEDQHIALQP DITDSPEKFS SDGGEDGRDV  240
DYPPTNMVPN HIANYDMHCK QELFPVNEFR NLHHNLPVHL DNHGIEAILP QSVAPHSLFR  300
ITAASTRSNY SAIHLPSSDF DQQMLQHMGT GSSAAGLFSP MPNNAYHAII DDHPPRPHIR  360
GMGYRNSSEI LNGLAEFQSF GHPALQGDQT LTDVVSRPLE RLQQLQQSTS DLLSTNSVHD  420
VIHNFGMPSL SWQARPQSHF VEFCTNPDSI NSHSSTFLSS GE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-403119413165NAC domain-containing protein 19
4dul_A6e-403119413165NAC domain-containing protein 19
1ut7_B6e-403119413165NO APICAL MERISTEM PROTEIN
1ut7_A6e-403119413165NO APICAL MERISTEM PROTEIN
1ut4_B6e-403119413165NO APICAL MERISTEM PROTEIN
1ut4_A6e-403119413165NO APICAL MERISTEM PROTEIN
3swp_D6e-403119416168NAC domain-containing protein 19
3swp_C6e-403119416168NAC domain-containing protein 19
3swp_B6e-403119416168NAC domain-containing protein 19
3swp_A6e-403119416168NAC domain-containing protein 19
3swm_D6e-403119416168NAC domain-containing protein 19
3swm_C6e-403119416168NAC domain-containing protein 19
3swm_B6e-403119416168NAC domain-containing protein 19
3swm_A6e-403119416168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8980840.0AB898084.1 Physcomitrella patens PpVNS4 mRNA for NAC transcription factor PpVNS4, complete cds, ecotype: Gransden 2004.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001765526.10.0predicted protein
TrEMBLX5IXP80.0X5IXP8_PHYPA; NAC transcription factor PpVNS4
STRINGPP1S77_42V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.13e-67NAC domain containing protein 70
Publications ? help Back to Top
  1. Xu B, et al.
    Contribution of NAC transcription factors to plant adaptation to land.
    Science, 2014. 343(6178): p. 1505-8
    [PMID:24652936]