PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c5_740V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 411aa    MW: 45837.6 Da    PI: 9.1797
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c5_740V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.45.9e-53151421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelv +yL++k++++ + +  vi+evd+yk++PwdLp k+  +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++ 
  Pp3c5_740V3.2.p  15 LPPGFRFHPTDEELVLHYLRRKADSHVFLI-PVIAEVDLYKFDPWDLPDKALFGEREWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKPIFM 107
                      79************************9888.88***************8777899*************************************99 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + ++++vg+kk Lvfy+g+apkgekt+W+mheyrl
  Pp3c5_740V3.2.p 108 TnSHSKVGVKKALVFYRGKAPKGEKTNWIMHEYRL 142
                      856778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-637171IPR003441NAC domain
PROSITE profilePS5100561.51115171IPR003441NAC domain
PfamPF023653.8E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MVTMETTGSL AQLQLPPGFR FHPTDEELVL HYLRRKADSH VFLIPVIAEV DLYKFDPWDL  60
PDKALFGERE WYFFSPRDRK YPNGARPNRA AASGYWKATG TDKPIFMTNS HSKVGVKKAL  120
VFYRGKAPKG EKTNWIMHEY RLAEGVSPPA RHHRRGSLRL DDWVLCRIYE KCTHAQRAGM  180
EHDTSSVQKM LASLPKIDNP NHMLPGLNTV SMTESAQHMA MINSMLAKNT SDDGCSLPAS  240
ISTLQRGMMS SDSGIAVHDL HTGNMASGWK GQSFMDYTGN QNLRYNTQQE LEAGSSSPRP  300
TLNIRSSMAG SVVPQFQHPH RSYSNFGPRI VEKPMPPAPG RSASDQEVQS SFRSTMQFTN  360
GTSCNEGLES MFPEIGNFDH QTQSTISSYS RPGMGYSTFS YRHGASSSLN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-8141779174NAC domain-containing protein 19
3swm_B3e-8141779174NAC domain-containing protein 19
3swm_C3e-8141779174NAC domain-containing protein 19
3swm_D3e-8141779174NAC domain-containing protein 19
3swp_A3e-8141779174NAC domain-containing protein 19
3swp_B3e-8141779174NAC domain-containing protein 19
3swp_C3e-8141779174NAC domain-containing protein 19
3swp_D3e-8141779174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001769642.11e-140predicted protein, partial
TrEMBLA9STG21e-140A9STG2_PHYPA; Predicted protein (Fragment)
STRINGPP1S259_83V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.15e-85NAC domain containing protein 25