PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c5_6470V3.8.p
Common NamePHYPADRAFT_122672
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 165aa    MW: 19048.3 Da    PI: 6.7449
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c5_6470V3.8.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.2e-2049101456
                       -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       + +ftk ql++Le+ Fe+ + p+a+++  LA++lg++ rqV vWFqNrRa+ k
  Pp3c5_6470V3.8.p  49 KLRFTKAQLRVLEDTFERLQRPNAHQKSTLAMELGVQPRQVEVWFQNRRARGK 101
                       568************************************************88 PP

2HD-ZIP_I/II93.72e-3048128282
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLek 82 
                       +k+r++k q+++LE++Fe+ ++ + ++K++la eLg+qprqv+vWFqnrRAR k+k+ E+d+e+L+++++ l  en++L+ 
  Pp3c5_6470V3.8.p  48 QKLRFTKAQLRVLEDTFERLQRPNAHQKSTLAMELGVQPRQVEVWFQNRRARGKAKRNESDCEVLRQRCQDLLVENHHLSY 128
                       79**************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.15143103IPR001356Homeobox domain
SuperFamilySSF466893.08E-1845102IPR009057Homeodomain-like
SMARTSM003896.4E-1645107IPR001356Homeobox domain
PfamPF000469.7E-1849101IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-1950107IPR009057Homeodomain-like
CDDcd000862.67E-145199No hitNo description
PRINTSPR000311.7E-57483IPR000047Helix-turn-helix motif
PROSITE patternPS00027078101IPR017970Homeobox, conserved site
PRINTSPR000311.7E-58399IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MGSCDCEESS LSSILTLQDQ REMFRSVFPG RSSDNSQEYD EDDEGSSQKL RFTKAQLRVL  60
EDTFERLQRP NAHQKSTLAM ELGVQPRQVE VWFQNRRARG KAKRNESDCE VLRQRCQDLL  120
VENHHLSYLI QTERMGYDSR QLSNEGGPLL QMALCNNCKK LRNC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.1600.0gametophore| protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0280740.0AB028074.1 Physcomitrella patens mRNA for homeobox protein PpHB3, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024377013.11e-119homeobox-leucine zipper protein HOX17-like
RefseqXP_024377014.11e-119homeobox-leucine zipper protein HOX17-like
RefseqXP_024377015.11e-119homeobox-leucine zipper protein HOX17-like
RefseqXP_024377016.11e-119homeobox-leucine zipper protein HOX17-like
RefseqXP_024377017.11e-119homeobox-leucine zipper protein HOX17-like
RefseqXP_024377018.11e-119homeobox-leucine zipper protein HOX17-like
RefseqXP_024377019.11e-119homeobox-leucine zipper protein HOX17-like
RefseqXP_024377020.11e-119homeobox-leucine zipper protein HOX17-like
RefseqXP_024377021.11e-119homeobox-leucine zipper protein HOX17-like
TrEMBLA0A2K1KIR31e-117A0A2K1KIR3_PHYPA; Uncharacterized protein
TrEMBLA9S1J71e-117A9S1J7_PHYPA; Predicted protein (Fragment)
TrEMBLQ9LS351e-117Q9LS35_PHYPA; Homeobox protein PpHB3 (Fragment)
STRINGPP1S41_32V6.11e-118(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-24homeobox protein 2
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]