PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c5_630V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 326aa    MW: 36374.2 Da    PI: 7.381
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c5_630V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.49.6e-52141431128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelv +yL +k+e++ +++  vi+e+d+yk++PwdLp k+  +e ewyfFs+rd+ky++g r+nra++sgyWkatg+d++v++
  Pp3c5_630V3.2.p  14 LPPGFRFHPTDEELVLHYLWRKAESEMFSI-PVITELDLYKFDPWDLPGKAIFGEGEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDRPVHK 106
                      79*************************999.89***************76667889*************************************9 PP

              NAM  95 k...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +   + +++g+kk Lvfykgrapkg+kt Wvmheyrl
  Pp3c5_630V3.2.p 107 AsrgTLQKIGVKKALVFYKGRAPKGVKTAWVMHEYRL 143
                      87666677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-624173IPR003441NAC domain
PROSITE profilePS5100559.17114173IPR003441NAC domain
PfamPF023652.7E-2715143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MASSSNVPLS EIELPPGFRF HPTDEELVLH YLWRKAESEM FSIPVITELD LYKFDPWDLP  60
GKAIFGEGEW YFFSPRDRKY PNGARPNRAA ASGYWKATGT DRPVHKASRG TLQKIGVKKA  120
LVFYKGRAPK GVKTAWVMHE YRLANGMCSP SSIHRKPDSL RLDDWVLCRI LHKSPSVQRA  180
SGKVRSSSNV EEVLPSLPEM ENSSFVMPSM GRGSCGLLDV DTLWEEKANL AEERLMNHQL  240
LNNASAMQPI SSWMSNQTAQ LHLNSYFDGL LAISEPFYLG SMSTFDSANT HTLLPVAVSE  300
QSATVSTFSS FPSSRTHEYP DHSVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-7411794171NO APICAL MERISTEM PROTEIN
1ut4_B2e-7411794171NO APICAL MERISTEM PROTEIN
1ut7_A2e-7411794171NO APICAL MERISTEM PROTEIN
1ut7_B2e-7411794171NO APICAL MERISTEM PROTEIN
3swm_A2e-7411797174NAC domain-containing protein 19
3swm_B2e-7411797174NAC domain-containing protein 19
3swm_C2e-7411797174NAC domain-containing protein 19
3swm_D2e-7411797174NAC domain-containing protein 19
3swp_A2e-7411797174NAC domain-containing protein 19
3swp_B2e-7411797174NAC domain-containing protein 19
3swp_C2e-7411797174NAC domain-containing protein 19
3swp_D2e-7411797174NAC domain-containing protein 19
4dul_A2e-7411794171NAC domain-containing protein 19
4dul_B2e-7411794171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001779492.11e-143predicted protein
SwissprotQ390132e-78NAC2_ARATH; NAC domain-containing protein 2
SwissprotQ8H4S43e-78NAC10_ORYSJ; NAC transcription factor ONAC010
TrEMBLA9TLK31e-143A9TLK3_PHYPA; Predicted protein
STRINGPP1S259_67V6.11e-142(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-79NAC family protein