PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c5_27150V3.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 311aa    MW: 35455.6 Da    PI: 4.4754
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c5_27150V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.93.6e-1855108356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k++++t +q++ Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Pp3c5_27150V3.4.p  55 KKRRLTFDQVRSLEKNFEIENKLEPERKLQLAQELGLQPRQVAVWFQNRRARWK 108
                        45578999*********************************************9 PP

2HD-ZIP_I/II1201.3e-3854145192
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrl+ +qv++LE++Fe e+kLeperK +la+eLglqprqvavWFqnrRAR+ktkqlE+dye+L   y++lk++ + + +e+++L+ee++
  Pp3c5_27150V3.4.p  54 EKKRRLTFDQVRSLEKNFEIENKLEPERKLQLAQELGLQPRQVAVWFQNRRARWKTKQLERDYEVLSLDYNQLKNKFDDVVQEKQQLQEEMD 145
                        69*************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.19E-2042112IPR009057Homeodomain-like
PROSITE profilePS5007117.7550110IPR001356Homeobox domain
SMARTSM003896.7E-1553114IPR001356Homeobox domain
PfamPF000461.3E-1555108IPR001356Homeobox domain
CDDcd000866.47E-1655111No hitNo description
Gene3DG3DSA:1.10.10.601.6E-1957117IPR009057Homeodomain-like
PRINTSPR000317.3E-68190IPR000047Helix-turn-helix motif
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
PRINTSPR000317.3E-690106IPR000047Helix-turn-helix motif
PfamPF021837.6E-14110151IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MQKHFRVFLV QLAGGGLEDA VASCSQKRPY YSSFEASGED PGDEEIEDCT QQVEKKRRLT  60
FDQVRSLEKN FEIENKLEPE RKLQLAQELG LQPRQVAVWF QNRRARWKTK QLERDYEVLS  120
LDYNQLKNKF DDVVQEKQQL QEEMDCLRGK LPTPQPSSVL GAKEQSKKLK TASQPSPPKM  180
SEASVKLEQI CTEHTASYDA LVPFLEGDSS FESSDSMSSE IVNADSPRTS DSISLVPLNE  240
FTTYPHIPTD SMVDSSIIHM SDSICDQMLS PIDCHRISVK LEDGSFQDES CNYMLSQLDE  300
ERGLPWWDWP *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102110RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.153021e-123gametophore
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024374921.10.0homeobox-leucine zipper protein HAT5-like isoform X2
TrEMBLA0A2K1KL890.0A0A2K1KL89_PHYPA; Uncharacterized protein
STRINGPP1S154_145V6.20.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-41homeobox 1