PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c5_14440V3.1.p
Common NamePHYPADRAFT_88451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 400aa    MW: 43856.2 Da    PI: 6.8364
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c5_14440V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.31.4e-3755113462
             zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        k ++cprC+s+ntkfCyynnys++qPr+fC++C+ryWt GG+lrnvPvGgg+rk+ +++
  Pp3c5_14440V3.1.p  55 KVIPCPRCQSMNTKFCYYNNYSVNQPRHFCRNCQRYWTVGGTLRNVPVGGGSRKKTRTR 113
                        5789**************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2055102IPR003851Zinc finger, Dof-type
PfamPF027013.9E-3256111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.49157111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MYLPMNRQKV LRDFEDDSND ELQAGLNDSR SPSGEGDSPV GTRGNGGCIR DKLVKVIPCP  60
RCQSMNTKFC YYNNYSVNQP RHFCRNCQRY WTVGGTLRNV PVGGGSRKKT RTRSRTDPYL  120
RSGTPQTSPI RTLSGSGGDL LSASACMQQL SMLPPSGGML GFGDQLSAFG PAGLQLPSSH  180
LALEQSLGTY PPLQKPLSGL QEVPDLQSLY EVPQVPQIPQ VSPAMLSSFS PMMMNSGFFL  240
PEMHVPSQSD ALASVMAKAC MWSNPAQQLP SLNGISQAQR SWEESQSKPP MNSQLQNLSG  300
YEERAAPANQ MNASGWPQNL KPGFWEAALM QSHPVMNDRL VPHTSWDENQ CSTHTNLSPN  360
ASSTTDEEWC PPRNCFSHGY EDASQSWVGL QASDILRYQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.154430.0gametophore
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024376052.10.0uncharacterized protein LOC112282555 isoform X2
RefseqXP_024376053.10.0uncharacterized protein LOC112282555 isoform X2
RefseqXP_024376054.10.0uncharacterized protein LOC112282555 isoform X2
TrEMBLA0A2K1KJN30.0A0A2K1KJN3_PHYPA; Uncharacterized protein
STRINGPP1S169_171V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.11e-26Dof family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]