PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c5_12180V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family CO-like
Protein Properties Length: 562aa    MW: 60566.4 Da    PI: 5.8441
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c5_12180V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.23e-07244339
           zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                       e++C+ ++e +++ +C+ ++ llC +C ++ H+       H++
  Pp3c5_12180V3.1.p  2 ETTCDFCGEGQATVYCRADSALLCLSCDQHVHSAnalsqrHSR 44
                       689******77*********************65677777765 PP

2zf-B_box17.49.4e-064685437
           zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                         C  ++  ++   C++Cq ++C++C +++H+       H
  Pp3c5_12180V3.1.p 46 LLCHGCNMRPAGVRCTTCQNCFCQTCDDNTHSPsmmsaqH 85
                       57****************************9435666665 PP

3CCT58.91.7e-20504547144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        R+ a+lRYkeKrk R+F+K++rYesRKa+A+ R+RvKGrFvk+ 
  Pp3c5_12180V3.1.p 504 RDSAMLRYKEKRKIRRFDKRVRYESRKARADIRKRVKGRFVKAG 547
                        899**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003368.1E-11147IPR000315B-box-type zinc finger
PROSITE profilePS5011910.125147IPR000315B-box-type zinc finger
PfamPF006431.4E-5244IPR000315B-box-type zinc finger
CDDcd000219.53E-9547No hitNo description
PROSITE profilePS501198.8024390IPR000315B-box-type zinc finger
PROSITE profilePS5101715.269504546IPR010402CCT domain
PfamPF062034.8E-15504546IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
METTCDFCGE GQATVYCRAD SALLCLSCDQ HVHSANALSQ RHSRTLLCHG CNMRPAGVRC  60
TTCQNCFCQT CDDNTHSPSM MSAQHQRHVL ECFTGCPSAS ELAALWACDN CSDVGGPISS  120
VFSRGLNSKW AEIAGSSATR STVARENQMG GAQRMDSSSG VAAVGVTNIS SAAPPLLAKS  180
AVLPSTSAVA RQQEQGCIEK EISQQLQVLQ VQDLARTSSA SLPVQQAKRQ CVNTQTSSQT  240
QQESEQCSPM PVRRHSDQQP AQNSGVSGGE SSMGVDDGQM MKLEDGPNDL VNQGGPDPFW  300
RSNALTQATQ MWGQNMQDLG VCGEVSDPCD AFSMADVDLF FDNYEDMFSS GSGPSRSSFE  360
EISPRCSSIG QDSANASNDH ARMQSIPEAE LFKPINQDAA TTANDIKLRE NMVRQAGPGP  420
GPVPPELHEM AVLMAMNDMD RTPCNMGSQF PAGPALTSRS LTLPGRSGDS GDYQDCNLSP  480
LFFSSGEASL GSRSPDSVSI AQARDSAMLR YKEKRKIRRF DKRVRYESRK ARADIRKRVK  540
GRFVKAGQAY DYDPLATTRS F*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.120120.0gametophore| protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024375952.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_024375954.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_024375955.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_024375956.10.0zinc finger protein CONSTANS-LIKE 9-like
TrEMBLA0A2K1KJD20.0A0A2K1KJD2_PHYPA; Uncharacterized protein
STRINGPP1S236_21V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.15e-29B-box type zinc finger protein with CCT domain