PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c4_850V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 384aa    MW: 41392.1 Da    PI: 7.6324
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c4_850V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.56.2e-3845104261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      ++k l+cprC+s+ntkfCyynnys++qPr+fC++C+ryWt GG+lrnvPvGgg+rk++++
  Pp3c4_850V3.1.p  45 PQKVLPCPRCESMNTKFCYYNNYSVNQPRHFCRQCQRYWTVGGTLRNVPVGGGSRKKHRH 104
                      78999***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2532100IPR003851Zinc finger, Dof-type
PfamPF027012.4E-3247103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.45349103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MVLLTASKDG TTEGSLEKKA RKLALDGTTI PLTPDSPGKK ALEKPQKVLP CPRCESMNTK  60
FCYYNNYSVN QPRHFCRQCQ RYWTVGGTLR NVPVGGGSRK KHRHQRQEPY MRTAPGSVTS  120
PLALATAGGQ PGMANMGFQQ LLTHDMSGFN FSQLPGFVPQ TLYPAYPVDQ SQGMYAQPLS  180
NKSTQHEFQS MHPACGVMNP QSLPTATGHY CGTDVGAQLQ GDNGVNTNGA AGPVKHEFWS  240
NMMPQNPHLQ AGNHSVQSLW EECKVTSGTV PTTTADSDAR KAGALVDLQA VAKSGGYDSS  300
MLLHLGLNTR PQVSGKPSFS NHNQLDSRGV AHPTNGSSPP HGSSTIEEEG STPTNGYSNN  360
GYEEGDTVSS MWQDMHDIHD IFQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.68030.0gametophore| protonema
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024373861.10.0uncharacterized protein LOC112281500
RefseqXP_024373862.10.0uncharacterized protein LOC112281500
RefseqXP_024373864.10.0uncharacterized protein LOC112281500
RefseqXP_024373865.10.0uncharacterized protein LOC112281500
TrEMBLA0A2K1KLP50.0A0A2K1KLP5_PHYPA; Uncharacterized protein
STRINGPP1S267_24V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.12e-32cycling DOF factor 1