PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c4_7260V3.2.p
Common NamePHYPADRAFT_86211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 333aa    MW: 37199.1 Da    PI: 4.5915
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c4_7260V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.7e-1882135356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t +q++ Le+ Fe  +++  e++ +LAk+lgL  rqV vWFqNrRa++k
  Pp3c4_7260V3.2.p  82 KKRRLTLDQVRSLETSFEVVNKLEPEKKMQLAKELGLRPRQVAVWFQNRRARWK 135
                       56689************************************************9 PP

2HD-ZIP_I/II120.39.9e-3981172192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       ekkrrl+ +qv++LE+sFe  +kLepe+K++la+eLgl+prqvavWFqnrRAR+ktkqlE+dye+L + y++l+++ e++ +e + Lr+e+ 
  Pp3c4_7260V3.2.p  81 EKKRRLTLDQVRSLETSFEVVNKLEPEKKMQLAKELGLRPRQVAVWFQNRRARWKTKQLERDYETLAADYKTLMADYEHVVEERNCLRAEVV 172
                       69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-2060138IPR009057Homeodomain-like
SuperFamilySSF466891.46E-1869139IPR009057Homeodomain-like
PROSITE profilePS5007117.16777137IPR001356Homeobox domain
SMARTSM003892.0E-1680141IPR001356Homeobox domain
CDDcd000865.85E-1682138No hitNo description
PfamPF000461.2E-1582135IPR001356Homeobox domain
PRINTSPR000319.4E-6108117IPR000047Helix-turn-helix motif
PROSITE patternPS000270112135IPR017970Homeobox, conserved site
PRINTSPR000319.4E-6117133IPR000047Helix-turn-helix motif
PfamPF021837.3E-14137177IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MLQLLCNDSS SDSLTAELAP CFLQVGLQAP LHVGVSLEDT IVQGSGHKRP FHDACDTPTG  60
EDGSAEDDEG GDDSPTGSHN EKKRRLTLDQ VRSLETSFEV VNKLEPEKKM QLAKELGLRP  120
RQVAVWFQNR RARWKTKQLE RDYETLAADY KTLMADYEHV VEERNCLRAE VVRLTGETPP  180
SPQTDRNKSV NDRAPQTPER EVVISGAVAR QRTSRISSTV DISLVCAKDQ DSETNGLNDG  240
NSGDVVNADS PRISDCSSPT SMPDQEQLIH SPEFPPPKSF GDLDHLLHEL HHDVPMKLED  300
ESGHCLHDDQ SCNYLLFHPE EQTCVLPWWD WP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129137RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024372505.10.0homeobox-leucine zipper protein HOX20-like
TrEMBLA9SZT90.0A9SZT9_PHYPA; Predicted protein
STRINGPP1S143_73V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-38homeobox 1
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]