PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c4_18330V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 352aa    MW: 39020.3 Da    PI: 7.1864
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c4_18330V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.77.3e-42461461101
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        aCaaCk++rrkCa+dC+lapyfp +qpk+f nvh+lFG+s +l++l+++++++red+++s+vyeA+ r +dPv+G++gvi+ lq+q+++lk 
  Pp3c4_18330V3.2.p  46 ACAACKYQRRKCATDCPLAPYFPPDQPKRFLNVHRLFGVSSILRILRQVDPDKREDTVKSIVYEADTREKDPVHGCLGVIHLLQNQVNKLKD 137
                        7******************************************************************************************* PP

             DUF260  93 elallkeel 101
                        el++++e+l
  Pp3c4_18330V3.2.p 138 ELVVAREQL 146
                        ***999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.22845146IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4046143IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MQRLKSLEDS SKMTAPPKIS TSGERSIVTG GVGPSSSEPL PGTNTACAAC KYQRRKCATD  60
CPLAPYFPPD QPKRFLNVHR LFGVSSILRI LRQVDPDKRE DTVKSIVYEA DTREKDPVHG  120
CLGVIHLLQN QVNKLKDELV VAREQLFLLE QQHSTSILQQ NYGHSHGGGQ QNYHYHHTQP  180
QYHASTTHQS GNFHDPAPVQ IMTYQDSRAS HAAYHDHARY LAVSDSALHD MLGQQITKME  240
STDPYSSSLS SMRYGSDSGP GSLHVHEHQQ NQQNLGEQQH QGGGSSYTVA GDLERRIFYN  300
PLVDTHAGRH VDPLRSVAAM QGLDTLNPHQ VSDHELRNAG VHLSLTNQYS I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-36411476112LOB family transfactor Ramosa2.1
5ly0_B5e-36411476112LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024374784.10.0LOB domain-containing protein 7-like
TrEMBLA0A2K1KP090.0A0A2K1KP09_PHYPA; Uncharacterized protein
STRINGPP1S13_89V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.13e-39LOB domain-containing protein 25