PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c4_11490V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 426aa    MW: 47389.8 Da    PI: 4.9955
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c4_11490V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.84e-57221501129
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGfrFhPtdeelv++yL+kkv ++++++ ++i+evd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd++v
  Pp3c4_11490V3.1.p  22 LPPGFRFHPTDEELVSYYLTKKVLDSRFTV-HAIAEVDLNKCEPWDLPVKAKMGEKEWYFFSLRDRKYPTGMRTNRATDAGYWKATGKDRDV 112
                        79***************************9.88***************99999*************************************** PP

                NAM  93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                        +++ +++lvg+kktLvfy+grapkgekt+W+mheyrle
  Pp3c4_11490V3.1.p 113 FAHgRSHLVGMKKTLVFYRGRAPKGEKTNWIMHEYRLE 150
                        *9877888****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-6417174IPR003441NAC domain
PROSITE profilePS5100561.20522174IPR003441NAC domain
PfamPF023651.2E-2823149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048504Biological Processregulation of timing of organ formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MADTSVQGPQ DTDQSQQGEP FLPPGFRFHP TDEELVSYYL TKKVLDSRFT VHAIAEVDLN  60
KCEPWDLPVK AKMGEKEWYF FSLRDRKYPT GMRTNRATDA GYWKATGKDR DVFAHGRSHL  120
VGMKKTLVFY RGRAPKGEKT NWIMHEYRLE GDGGHSLPPR VNKDEWVVCR IFQKSSGAKR  180
SFLFSDSRMR QAIVYQLEDV RSSLPPDMDN NSPNPTVTDG GTCTDCETCA GTEQMSACYN  240
CVHDFDHDKD TNGVMSWINT QPAGMDILQQ VGGLNNLNNL LSKPYPMYDA SYEKGMNLPR  300
QLGFTPQVLM QPANMTTPTG LRVASLRPKT EPSSFSEGED EAQSIPEGYE YGAWQTEKAE  360
ASLYNNDGTG DDSSSPLQSS TGGTELSCLT GSLCSGENGS YKYRLPDITA PVDAGFGHEI  420
LTWAY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-5651802171NAC domain-containing protein 19
4dul_A2e-5651802171NAC domain-containing protein 19
1ut7_B2e-5651802171NO APICAL MERISTEM PROTEIN
1ut7_A2e-5651802171NO APICAL MERISTEM PROTEIN
1ut4_B2e-5651802171NO APICAL MERISTEM PROTEIN
1ut4_A2e-5651802171NO APICAL MERISTEM PROTEIN
3swp_D2e-5681808174NAC domain-containing protein 19
3swp_C2e-5681808174NAC domain-containing protein 19
3swp_B2e-5681808174NAC domain-containing protein 19
3swp_A2e-5681808174NAC domain-containing protein 19
3swm_D2e-5681808174NAC domain-containing protein 19
3swm_C2e-5681808174NAC domain-containing protein 19
3swm_B2e-5681808174NAC domain-containing protein 19
3swm_A2e-5681808174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001761033.11e-169predicted protein, partial
TrEMBLA9S3Z41e-169A9S3Z4_PHYPA; Predicted protein (Fragment)
STRINGPP1S227_100V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.12e-84NAC family protein