PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_950V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 638aa    MW: 68107.8 Da    PI: 8.1407
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_950V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.1e-39211269260
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                      ++k ++cprCds +tkfCyynny+++qPr+fCk+C+ryWt+GG+lrnvPvG+grrknk+
  Pp3c3_950V3.1.p 211 PDKVVSCPRCDSLETKFCYYNNYNINQPRHFCKNCQRYWTAGGTLRNVPVGAGRRKNKH 269
                      78999****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-29208268IPR003851Zinc finger, Dof-type
PfamPF027014.7E-32212269IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.509215269IPR003851Zinc finger, Dof-type
PROSITE patternPS013610217253IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MSSEKLCDRR EGLLLLSANP KFCAGVKFPG LTNRVVSDSL YQELPSEEGK GVALDVVEQA  60
TMPDPFEWTL GVQPGCPKAT MDPEIKLFGQ TIGVASSRAD AGADAGVLKP TSASPPWNTA  120
RSSKQDGGDS SLFRNENEGG VVEKLRTARS SSRDEFLQPP KSTELVPGNR STMIFSLGAS  180
DSEGAHSDEL KDQGEGDHSQ YLGDDKHLQK PDKVVSCPRC DSLETKFCYY NNYNINQPRH  240
FCKNCQRYWT AGGTLRNVPV GAGRRKNKHG VVQRDCTEAS VNCSIQSDSS DSASQLLPCA  300
LGSPTSQKAG SSLKHSQPKR LVGQGSPMRS PRSTMSFSQD SGITLPPPFS LHRNGPIPYQ  360
SFSSSQGFLT SGSEVYTVGS SDSSSVTIGQ RIARFPSVNG MDKDCSRSSL SGQLQATHSL  420
RSMTTVYNPS LQLESSSGMH RSVLPPGSSG WPGNGAPAGL HSGEWPHNHL ELDGKHSTQV  480
VGTTYNTATT LPATSSWSAA NAQWGATQWG AGVSHLSNPA QMPTQVWPGG QQPMAPNATP  540
LDHSVVAVLS TLGKRGLSDE GSSMWPSKAL RPHGSRSLNS WSMSGKDQSE VNSSGNALNL  600
FRPKLEIGVA CETKDSFVSR HFTTVPPARP VPFQVTI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.176860.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6267020.0AB626702.1 Physcomitrella patens PpDof5 mRNA for Dof transcription factor, partial cds, a part of 5' portion.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024370377.10.0uncharacterized protein LOC112279878
TrEMBLA0A2K1KSS20.0A0A2K1KSS2_PHYPA; Uncharacterized protein
STRINGPP1S1_286V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.17e-35cycling DOF factor 1