PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_9350V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LFY
Protein Properties Length: 280aa    MW: 30950.5 Da    PI: 8.0268
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_9350V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY41.22.8e-1314622138116
           FLO_LFY  38 eaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavrae 116
                        ++aa + +++ +le +f ++G+r  t+ ki+e+Gft +t++   d el  l++s+ +  ++ l +Ge +Gik a +  
  Pp3c3_9350V3.2.p 146 VKSAAPSLTEAADLESFFDGFGIRPETIGKIKEMGFTGKTFMSNVD-ELLTLLDSIKQ--HCHLTLGEEWGIKGAAKKW 221
                       233344455577*****************************98665.56678888887..577899*******997644 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016985.1E-8150219IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MVKVKGVEWN HVLVVKEPER HGMATLVRCA HCGKEFQGNA MRIRAHLLGN KRSAGVSGCP  60
SCPEDAREEL RIIDIAKSQV KRKRQDRTPR VPRATSSSDH SLDSAMQQMD FMTALQKGEK  120
SAVEQALRSM VFQGGLPVNF VNFSPVKSAA PSLTEAADLE SFFDGFGIRP ETIGKIKEMG  180
FTGKTFMSNV DELLTLLDSI KQHCHLTLGE EWGIKGAAKK WQKDHSMVFN QPELEKWPET  240
DNETANGCKE LSCLPSPVGE HAEMTQVKST LCGDKLRLN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.112440.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024369664.10.0uncharacterized protein LOC112279448
TrEMBLA0A2K1KTT20.0A0A2K1KTT2_PHYPA; Uncharacterized protein
STRINGPP1S140_156V6.11e-159(Physcomitrella patens)