PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_37710V3.4.p
Common NamePHYPADRAFT_132443
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 333aa    MW: 37501.2 Da    PI: 5.0106
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_37710V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.72.1e-1896149356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k++++t eq++ Le+ Fe ++++  e++ +LAk+lgL  rqV +WFqNrRa++k
  Pp3c3_37710V3.4.p  96 KKRRLTIEQVRSLEKNFEAENKLEPERKMRLAKELGLRPRQVAIWFQNRRARWK 149
                        45689************************************************9 PP

2HD-ZIP_I/II121.34.9e-3995187193
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrl+ eqv++LE++Fe+e+kLeperK++la+eLgl+prqva+WFqnrRAR+ktkqlE+dye+L + y++lk++ e++ +e+++L++el+
  Pp3c3_37710V3.4.p  95 EKKRRLTIEQVRSLEKNFEAENKLEPERKMRLAKELGLRPRQVAIWFQNRRARWKTKQLERDYETLESDYKRLKADYEQVLSEKNHLKAELQ 186
                        69***************************************************************************************998 PP

        HD-ZIP_I/II  93 e 93 
                        +
  Pp3c3_37710V3.4.p 187 R 187
                        5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-2072152IPR009057Homeodomain-like
SuperFamilySSF466891.15E-1984153IPR009057Homeodomain-like
PROSITE profilePS5007117.7591151IPR001356Homeobox domain
SMARTSM003892.4E-1594155IPR001356Homeobox domain
PfamPF000468.4E-1696149IPR001356Homeobox domain
CDDcd000861.76E-1596152No hitNo description
PRINTSPR000311.6E-5122131IPR000047Helix-turn-helix motif
PROSITE patternPS000270126149IPR017970Homeobox, conserved site
PRINTSPR000311.6E-5131147IPR000047Helix-turn-helix motif
PfamPF021834.3E-11151187IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MAITSMGHYS GQNEVFTGNG NTSDSFAAMI GPCSPHVDLQ ALRRSGGGLG DDGQSQGGGQ  60
KRRYFASYDA PKMEDGPEDA DEGTEDGTGN GSQLEKKRRL TIEQVRSLEK NFEAENKLEP  120
ERKMRLAKEL GLRPRQVAIW FQNRRARWKT KQLERDYETL ESDYKRLKAD YEQVLSEKNH  180
LKAELQRKSR DVPASKQDDN NLGLESIQTP ERDRHVSDSD ARQLNSRSSP TVDISRVKDE  240
ISGSTDGNSS DIVDADSPRT TNSSRKSVIQ SSDFPPESLM GHPQLLDTYP EEKIRLDTAV  300
KLEDNFHEDQ SCNYLLLHLD QQSGVLPWWD WP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143151RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.1590.0gametophore
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0280760.0AB028076.1 Physcomitrella patens mRNA for homeobox protein PpHB5, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024369881.10.0homeobox-leucine zipper protein HOX20-like isoform X2
RefseqXP_024369882.10.0homeobox-leucine zipper protein HOX20-like isoform X2
TrEMBLA9SN130.0A9SN13_PHYPA; Predicted protein
STRINGPP1S96_191V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-38HD-ZIP family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]