PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_26370V3.10.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 713aa    MW: 74054.4 Da    PI: 6.9854
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_26370V3.10.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.11.9e-38271331262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         ++k  +cprCds +tkfCyynny+++qPr+fCk+C+ryWt+GG lrnvPvG+grrk k+ss
  Pp3c3_26370V3.10.p 271 PDKLAPCPRCDSLDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGILRNVPVGAGRRKIKHSS 331
                         78899****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-26272328IPR003851Zinc finger, Dof-type
PfamPF027011.3E-31273329IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.164275329IPR003851Zinc finger, Dof-type
PROSITE patternPS013610277313IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 713 aa     Download sequence    Send to blast
MDSSSADTGG DKPRVLKSAT LLSRGLGSSG EGAGFRGQSG PAHVNMANGG SGPQKDYSLH  60
GTQLNRKEGA FADHINLNER REELQPSLHA RDVEGRVAGF GGGPSGVGAH ISGENPIKRD  120
EEGNHEDDGK GGAADELPGD EANVSSCSPL PFGRQEAKVV PLESIHSKAK GVEIIADGSA  180
LKSANNSKNE ASGASASVQI ASETTERNGP PLSQAVGDED ATVGPPPSHA PGDDADTAGP  240
PRPPAAADEA TVVPSPKQGK GQKQKPTLKK PDKLAPCPRC DSLDTKFCYY NNYNVNQPRH  300
FCKNCQRYWT AGGILRNVPV GAGRRKIKHS SSHPRHGAVP DIPAVRLDSL DMAQLRPCLS  360
RGSSVPHQVS PLLTCNASSP SNLNSLLNRQ ERGSSEAITQ TRSMHVAEAV RRHYISAESQ  420
VNIASDSGNR LLHAEHSDGC EPVLACEAEK DDCVEACTSS ATGSPSRTNV TPPTQEAQSM  480
LRGPPTTLIP VCGGVVRPVG ILDGSVWTAA PSPFGLFNGS WPYGYNVGWS GPAPGAPGPP  540
ICPPGGTLVS CQPAVTWSSP PNGIWSGICW GSTLIPGMPT GMPGPPWMSP GWGGGWPIPW  600
GPDAAAAAAA ASASASFQTA SAPMSGSGFP PVQSRLPIRP VLNKHPRDRP DLDRVESSLW  660
LPKMVKVDDS GSAPRSSVWT AVGAENRVET VVSGSNFKAF LPVADSKASD TS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.21760.0gametophore| protonema
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6267000.0AB626700.1 Physcomitrella patens PpDof4 mRNA for Dof transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024370803.10.0uncharacterized protein LOC112280065 isoform X1
RefseqXP_024370804.10.0uncharacterized protein LOC112280065 isoform X1
RefseqXP_024370805.10.0uncharacterized protein LOC112280065 isoform X1
RefseqXP_024370807.10.0uncharacterized protein LOC112280065 isoform X1
RefseqXP_024370808.10.0uncharacterized protein LOC112280065 isoform X1
TrEMBLA0A2K1KW530.0A0A2K1KW53_PHYPA; Uncharacterized protein
STRINGPP1S351_46V6.30.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.14e-34cycling DOF factor 3