PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_25610V3.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 425aa    MW: 47553.3 Da    PI: 5.3584
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_25610V3.5.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.93.2e-56221501129
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGfrFhPtdeelv++yL+kkv ++++ + ++i+evd++k+ePwdLp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd++v
  Pp3c3_25610V3.5.p  22 LPPGFRFHPTDEELVSYYLTKKVLDSRFAV-RAIAEVDLNKCEPWDLPEKAKMGEKEWYFFSLRDRKYPTGMRTNRATDAGYWKATGKDRDV 112
                        79**************************99.89***************99999*************************************** PP

                NAM  93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                        l++ + +l+g+kktLvfy grapkgekt+W+mheyrle
  Pp3c3_25610V3.5.p 113 LAHgRPRLIGMKKTLVFYMGRAPKGEKTNWIMHEYRLE 150
                        *9866678****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6419174IPR003441NAC domain
PROSITE profilePS5100561.58322174IPR003441NAC domain
PfamPF023658.4E-2923149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MAAPWHQEPQ GKDQSQRVES FLPPGFRFHP TDEELVSYYL TKKVLDSRFA VRAIAEVDLN  60
KCEPWDLPEK AKMGEKEWYF FSLRDRKYPT GMRTNRATDA GYWKATGKDR DVLAHGRPRL  120
IGMKKTLVFY MGRAPKGEKT NWIMHEYRLE NDGGHPLSPR ANKDEWVVCR IFEKSSGGKR  180
GFSMSESHMR QGMAYQLEDA RSSLPPLMDN ESPNPTVIDE RTATNCETFV ETEQMSCYNR  240
VQDFDHKKEM NCVMSWINVQ PAGMDMVPQV GGLSSLDNGL PKPYPGNEIC EKSMSLSRQA  300
GFNQQALMQS ANMTTTTGFR VTSLRPKTEP LSFSEGEDEA QSTQKGCDYV NWPADLAGAS  360
LYQNDGTEGD SSSPLQSSTG GTDLSCLTGS LCSGENMSFD FKYRLQDITA PVDSGHGPEI  420
IGWA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-562218017171NO APICAL MERISTEM PROTEIN
1ut4_B4e-562218017171NO APICAL MERISTEM PROTEIN
1ut7_A4e-562218017171NO APICAL MERISTEM PROTEIN
1ut7_B4e-562218017171NO APICAL MERISTEM PROTEIN
3swm_A4e-562218020174NAC domain-containing protein 19
3swm_B4e-562218020174NAC domain-containing protein 19
3swm_C4e-562218020174NAC domain-containing protein 19
3swm_D4e-562218020174NAC domain-containing protein 19
3swp_A4e-562218020174NAC domain-containing protein 19
3swp_B4e-562218020174NAC domain-containing protein 19
3swp_C4e-562218020174NAC domain-containing protein 19
3swp_D4e-562218020174NAC domain-containing protein 19
4dul_A4e-562218017171NAC domain-containing protein 19
4dul_B4e-562218017171NAC domain-containing protein 19
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S288_4V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-83NAC family protein